BLASTX nr result
ID: Paeonia23_contig00041581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041581 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18799.1| hypothetical protein MIMGU_mgv1a001503mg [Mimulus... 63 4e-08 gb|EYU36158.1| hypothetical protein MIMGU_mgv1a001501mg [Mimulus... 63 5e-08 gb|EPS65359.1| hypothetical protein M569_09417, partial [Genlise... 63 5e-08 gb|EPS67558.1| hypothetical protein M569_07211, partial [Genlise... 62 8e-08 sp|Q96372.1|CDC48_CAPAN RecName: Full=Cell division cycle protei... 62 1e-07 ref|XP_006347195.1| PREDICTED: cell division cycle protein 48 ho... 62 1e-07 ref|XP_006340221.1| PREDICTED: cell division cycle protein 48 ho... 62 1e-07 ref|XP_004251158.1| PREDICTED: cell division cycle protein 48 ho... 62 1e-07 ref|XP_004241286.1| PREDICTED: cell division cycle protein 48 ho... 62 1e-07 gb|ACS28251.1| cell division control protein [Nicotiana glutinosa] 62 1e-07 ref|XP_006488039.1| PREDICTED: cell division cycle protein 48 ho... 61 2e-07 ref|XP_006424506.1| hypothetical protein CICLE_v10027840mg [Citr... 61 2e-07 ref|XP_002318682.2| hypothetical protein POPTR_0012s09000g [Popu... 61 2e-07 ref|XP_002281671.1| PREDICTED: cell division cycle protein 48 ho... 61 2e-07 ref|XP_002511356.1| Transitional endoplasmic reticulum ATPase, p... 61 2e-07 ref|XP_002321618.1| hypothetical protein POPTR_0015s09220g [Popu... 61 2e-07 emb|CAN61919.1| hypothetical protein VITISV_038729 [Vitis vinifera] 61 2e-07 ref|XP_006344438.1| PREDICTED: cell division cycle protein 48 ho... 60 2e-07 ref|XP_006439879.1| hypothetical protein CICLE_v10018887mg [Citr... 60 2e-07 ref|XP_004487074.1| PREDICTED: cell division cycle protein 48 ho... 60 2e-07 >gb|EYU18799.1| hypothetical protein MIMGU_mgv1a001503mg [Mimulus guttatus] Length = 807 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G HFL+R MRSVEFKVIE +PGEY VVA DT+I CEGE ++ E Sbjct: 154 GDHFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVRRE 197 >gb|EYU36158.1| hypothetical protein MIMGU_mgv1a001501mg [Mimulus guttatus] Length = 807 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G HFL+R MRSVEFKV+E +PGEY VVA DT+I CEGE ++ E Sbjct: 154 GDHFLVRGGMRSVEFKVVEADPGEYCVVAPDTEIFCEGEPVRRE 197 >gb|EPS65359.1| hypothetical protein M569_09417, partial [Genlisea aurea] Length = 767 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G HFL+R MRSVEFKV+E +PGEY VVA DT+I CEGE ++ E Sbjct: 136 GDHFLVRGGMRSVEFKVVETDPGEYCVVAPDTEIFCEGEPVRRE 179 >gb|EPS67558.1| hypothetical protein M569_07211, partial [Genlisea aurea] Length = 667 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 7 HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 HFL+R MRSVEFKV+E +PGEY VVA DT+I CEGE ++ E Sbjct: 28 HFLVRGGMRSVEFKVVETDPGEYCVVAPDTEIFCEGEPVRRE 69 >sp|Q96372.1|CDC48_CAPAN RecName: Full=Cell division cycle protein 48 homolog gi|1669660|emb|CAA70565.1| protein of AAA family [Capsicum annuum] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >ref|XP_006347195.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >ref|XP_006340221.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >ref|XP_004251158.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >ref|XP_004241286.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >gb|ACS28251.1| cell division control protein [Nicotiana glutinosa] Length = 805 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 G*HFLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 G +FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 154 GDNFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 197 >ref|XP_006488039.1| PREDICTED: cell division cycle protein 48 homolog [Citrus sinensis] Length = 807 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 157 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 197 >ref|XP_006424506.1| hypothetical protein CICLE_v10027840mg [Citrus clementina] gi|557526440|gb|ESR37746.1| hypothetical protein CICLE_v10027840mg [Citrus clementina] Length = 807 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 157 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 197 >ref|XP_002318682.2| hypothetical protein POPTR_0012s09000g [Populus trichocarpa] gi|550326702|gb|EEE96902.2| hypothetical protein POPTR_0012s09000g [Populus trichocarpa] Length = 810 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 159 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 199 >ref|XP_002281671.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera] gi|297733738|emb|CBI14985.3| unnamed protein product [Vitis vinifera] Length = 814 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 162 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 202 >ref|XP_002511356.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223550471|gb|EEF51958.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] Length = 804 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 162 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 202 >ref|XP_002321618.1| hypothetical protein POPTR_0015s09220g [Populus trichocarpa] gi|222868614|gb|EEF05745.1| hypothetical protein POPTR_0015s09220g [Populus trichocarpa] Length = 813 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 162 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 202 >emb|CAN61919.1| hypothetical protein VITISV_038729 [Vitis vinifera] Length = 802 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE IK E Sbjct: 150 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPIKRE 190 >ref|XP_006344438.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum] Length = 810 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 F++R MRSVEFKV+E EPGEY VVA DT+I CEGE IK E Sbjct: 158 FVVRGGMRSVEFKVVETEPGEYCVVAPDTEIFCEGEPIKRE 198 >ref|XP_006439879.1| hypothetical protein CICLE_v10018887mg [Citrus clementina] gi|557542141|gb|ESR53119.1| hypothetical protein CICLE_v10018887mg [Citrus clementina] Length = 813 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 164 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 204 >ref|XP_004487074.1| PREDICTED: cell division cycle protein 48 homolog [Cicer arietinum] Length = 808 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 10 FLIRR*MRSVEFKVIEIEPGEYYVVAQDTKISCEGESIKHE 132 FL+R MRSVEFKVIE +PGEY VVA DT+I CEGE +K E Sbjct: 156 FLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 196