BLASTX nr result
ID: Paeonia23_contig00041547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041547 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007044736.1| Tetratricopeptide repeat (TPR)-like superfam... 60 4e-07 >ref|XP_007044736.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508708671|gb|EOY00568.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 491 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 206 FESLTITYMAVGKTSPVMHHRLKIEKEEVSEFAKKLLERVS 84 FESL TY A G+TSPVMHHRLK+EK EVSE +KKL+E +S Sbjct: 449 FESLIRTYAAAGRTSPVMHHRLKMEKVEVSEASKKLVEVIS 489