BLASTX nr result
ID: Paeonia23_contig00041351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041351 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273910.2| PREDICTED: UPF0565 protein C2orf69 homolog [... 58 2e-06 ref|XP_004306987.1| PREDICTED: UPF0565 protein C2orf69 homolog [... 56 6e-06 >ref|XP_002273910.2| PREDICTED: UPF0565 protein C2orf69 homolog [Vitis vinifera] gi|147864514|emb|CAN82628.1| hypothetical protein VITISV_028129 [Vitis vinifera] gi|297734607|emb|CBI16658.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 180 RSLYKVAASLCLSPTSRTLAVPSANVIFFNGD 275 R LY+VAASLCLSPTS+TL VPSAN IFFNGD Sbjct: 17 RVLYRVAASLCLSPTSKTLIVPSANAIFFNGD 48 >ref|XP_004306987.1| PREDICTED: UPF0565 protein C2orf69 homolog [Fragaria vesca subsp. vesca] Length = 322 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 180 RSLYKVAASLCLSPTSRTLAVPSANVIFFNGD 275 RS Y+VAASLCLSPTS+TL VPSAN IFF GD Sbjct: 17 RSCYRVAASLCLSPTSKTLIVPSANAIFFGGD 48