BLASTX nr result
ID: Paeonia23_contig00041330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041330 (197 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007138392.1| hypothetical protein PHAVU_009G204800g [Phas... 75 1e-11 ref|XP_004514671.1| PREDICTED: transmembrane 9 superfamily membe... 74 2e-11 ref|XP_007204227.1| hypothetical protein PRUPE_ppa002742mg [Prun... 74 2e-11 ref|XP_002880556.1| hypothetical protein ARALYDRAFT_481272 [Arab... 74 2e-11 ref|NP_179994.2| Endomembrane protein 70 family protein [Arabido... 74 2e-11 gb|AAD03378.1| putative multispanning membrane protein [Arabidop... 74 2e-11 gb|EYU35328.1| hypothetical protein MIMGU_mgv1a002750mg [Mimulus... 74 3e-11 ref|XP_003527177.1| PREDICTED: transmembrane 9 superfamily membe... 74 3e-11 ref|XP_006293373.1| hypothetical protein CARUB_v10022803mg, part... 73 4e-11 ref|XP_007011925.1| Endomembrane protein 70 protein family [Theo... 73 5e-11 ref|XP_007221970.1| hypothetical protein PRUPE_ppa002736mg [Prun... 73 5e-11 ref|XP_004287134.1| PREDICTED: transmembrane 9 superfamily membe... 72 6e-11 ref|XP_003550684.1| PREDICTED: transmembrane 9 superfamily membe... 72 6e-11 ref|XP_003518221.1| PREDICTED: transmembrane 9 superfamily membe... 72 6e-11 emb|CBI36530.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002529382.1| Endosomal P24A protein precursor, putative [... 72 6e-11 ref|XP_002278700.1| PREDICTED: transmembrane 9 superfamily membe... 72 6e-11 ref|XP_004291962.1| PREDICTED: transmembrane 9 superfamily membe... 72 8e-11 ref|XP_006857241.1| hypothetical protein AMTR_s00065p00212630 [A... 72 1e-10 ref|XP_006483483.1| PREDICTED: transmembrane 9 superfamily membe... 71 2e-10 >ref|XP_007138392.1| hypothetical protein PHAVU_009G204800g [Phaseolus vulgaris] gi|561011479|gb|ESW10386.1| hypothetical protein PHAVU_009G204800g [Phaseolus vulgaris] Length = 643 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC P+HI DSAENL EVLRGD ENSP+VFKM QMCN++ Sbjct: 63 SYYSLPYCHPDHIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNVV 109 >ref|XP_004514671.1| PREDICTED: transmembrane 9 superfamily member 4-like [Cicer arietinum] Length = 637 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC P+HI DSAENL EVLRGD ENSP++FKM QMCN++ Sbjct: 57 SYYSLPYCRPDHIVDSAENLGEVLRGDRIENSPYMFKMREPQMCNVV 103 >ref|XP_007204227.1| hypothetical protein PRUPE_ppa002742mg [Prunus persica] gi|462399758|gb|EMJ05426.1| hypothetical protein PRUPE_ppa002742mg [Prunus persica] Length = 638 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PEHI DSAENL EVLRGD ENSP+ FKM QMCN++ Sbjct: 58 SYYSLPYCRPEHIVDSAENLGEVLRGDRIENSPYEFKMREPQMCNVV 104 >ref|XP_002880556.1| hypothetical protein ARALYDRAFT_481272 [Arabidopsis lyrata subsp. lyrata] gi|297326395|gb|EFH56815.1| hypothetical protein ARALYDRAFT_481272 [Arabidopsis lyrata subsp. lyrata] Length = 637 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMC 187 S+YSLPYC PEHI DSAENL EVLRGD ENSPFVFKM QMC Sbjct: 57 SYYSLPYCRPEHIVDSAENLGEVLRGDRIENSPFVFKMRESQMC 100 >ref|NP_179994.2| Endomembrane protein 70 family protein [Arabidopsis thaliana] gi|20259535|gb|AAM13887.1| putative multispanning membrane protein [Arabidopsis thaliana] gi|330252441|gb|AEC07535.1| Endomembrane protein 70 family protein [Arabidopsis thaliana] Length = 637 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMC 187 S+YSLPYC PEHI DSAENL EVLRGD ENSPFVFKM QMC Sbjct: 57 SYYSLPYCRPEHIVDSAENLGEVLRGDRIENSPFVFKMRESQMC 100 >gb|AAD03378.1| putative multispanning membrane protein [Arabidopsis thaliana] Length = 659 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMC 187 S+YSLPYC PEHI DSAENL EVLRGD ENSPFVFKM QMC Sbjct: 79 SYYSLPYCRPEHIVDSAENLGEVLRGDRIENSPFVFKMRESQMC 122 >gb|EYU35328.1| hypothetical protein MIMGU_mgv1a002750mg [Mimulus guttatus] Length = 641 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PE I DSAENL EVLRGD ENSP+VFKM QMCNI+ Sbjct: 62 SYYSLPYCKPEKIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNIV 108 >ref|XP_003527177.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine max] Length = 644 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC P HI DSAENL EVLRGD ENSP+VFKM QMCN++ Sbjct: 64 SYYSLPYCHPGHIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNVV 110 >ref|XP_006293373.1| hypothetical protein CARUB_v10022803mg, partial [Capsella rubella] gi|482562081|gb|EOA26271.1| hypothetical protein CARUB_v10022803mg, partial [Capsella rubella] Length = 652 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCN 190 S+YSLPYC P+HI DSAENL EVLRGD ENSPFVFKM QMC+ Sbjct: 72 SYYSLPYCRPDHIVDSAENLGEVLRGDRIENSPFVFKMRESQMCS 116 >ref|XP_007011925.1| Endomembrane protein 70 protein family [Theobroma cacao] gi|508782288|gb|EOY29544.1| Endomembrane protein 70 protein family [Theobroma cacao] Length = 638 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PE+I DSAENL EVLRGD ENSP++FKM QMCNI+ Sbjct: 58 SYYSLPYCRPENIVDSAENLGEVLRGDRIENSPYLFKMREPQMCNIV 104 >ref|XP_007221970.1| hypothetical protein PRUPE_ppa002736mg [Prunus persica] gi|462418906|gb|EMJ23169.1| hypothetical protein PRUPE_ppa002736mg [Prunus persica] Length = 639 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 SFYSLPYC P+ I DSAENL EVLRGD ENSP+VFKM QMCNI+ Sbjct: 58 SFYSLPYCRPDKILDSAENLGEVLRGDRIENSPYVFKMREPQMCNIV 104 >ref|XP_004287134.1| PREDICTED: transmembrane 9 superfamily member 4-like [Fragaria vesca subsp. vesca] Length = 638 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNI 193 SFYSLPYC PEHI DSAENL EVLRGD ENSP+ FKM QMC++ Sbjct: 58 SFYSLPYCRPEHIIDSAENLGEVLRGDRIENSPYEFKMREPQMCSV 103 >ref|XP_003550684.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine max] Length = 642 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNI 193 S+YSLPYC P+HI DSAENL EVLRGD ENSP+VFKM Q+CN+ Sbjct: 61 SYYSLPYCRPKHIFDSAENLGEVLRGDRIENSPYVFKMREPQLCNV 106 >ref|XP_003518221.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine max] Length = 642 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNI 193 S+YSLPYC P+HI DSAENL EVLRGD ENSP+VFKM Q+CN+ Sbjct: 61 SYYSLPYCRPKHIFDSAENLGEVLRGDRIENSPYVFKMREPQLCNV 106 >emb|CBI36530.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PE I DSAENL EVLRGD ENSP+VFKM QMCN++ Sbjct: 66 SYYSLPYCRPETIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNVV 112 >ref|XP_002529382.1| Endosomal P24A protein precursor, putative [Ricinus communis] gi|223531130|gb|EEF32978.1| Endosomal P24A protein precursor, putative [Ricinus communis] Length = 640 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PE I DSAENL EVLRGD ENSP+VFKM QMC IL Sbjct: 59 SYYSLPYCHPERIVDSAENLGEVLRGDRIENSPYVFKMREPQMCKIL 105 >ref|XP_002278700.1| PREDICTED: transmembrane 9 superfamily member 4 isoform 1 [Vitis vinifera] Length = 646 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC PE I DSAENL EVLRGD ENSP+VFKM QMCN++ Sbjct: 66 SYYSLPYCRPETIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNVV 112 >ref|XP_004291962.1| PREDICTED: transmembrane 9 superfamily member 4-like [Fragaria vesca subsp. vesca] Length = 640 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YSLPYC P+ I DSAENL EVLRGD ENSP+VFKM QMCNI+ Sbjct: 59 SYYSLPYCKPDKILDSAENLGEVLRGDRIENSPYVFKMREPQMCNIV 105 >ref|XP_006857241.1| hypothetical protein AMTR_s00065p00212630 [Amborella trichopoda] gi|548861324|gb|ERN18708.1| hypothetical protein AMTR_s00065p00212630 [Amborella trichopoda] Length = 638 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCN 190 S+YSLPYC PE I DSAENL EVLRGD ENSP+VF+M + QMCN Sbjct: 59 SYYSLPYCHPEKITDSAENLGEVLRGDRIENSPYVFQMRIPQMCN 103 >ref|XP_006483483.1| PREDICTED: transmembrane 9 superfamily member 4-like [Citrus sinensis] Length = 642 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +2 Query: 56 SFYSLPYCSPEHIADSAENLREVLRGDCTENSPFVFKM*VLQMCNIL 196 S+YS+PYC P+ I DSAENL EVLRGD ENSP+VFKM QMCN++ Sbjct: 62 SYYSIPYCRPKKIVDSAENLGEVLRGDRIENSPYVFKMREPQMCNVI 108