BLASTX nr result
ID: Paeonia23_contig00041308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041308 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035447.1| DNAJ heat shock N-terminal domain-containing... 59 7e-07 >ref|XP_007035447.1| DNAJ heat shock N-terminal domain-containing protein, putative [Theobroma cacao] gi|508714476|gb|EOY06373.1| DNAJ heat shock N-terminal domain-containing protein, putative [Theobroma cacao] Length = 978 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +2 Query: 2 ITWFEPHPDEQGQIEWVDNNLPFDCDRFTHGDSLITTDRLIF 127 ITW EP PD++ ++EWV+ LP C +F HG S IT DRL+F Sbjct: 531 ITWLEPDPDDENEVEWVNEGLPVSCGKFKHGVSEITEDRLMF 572