BLASTX nr result
ID: Paeonia23_contig00041130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041130 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007301378.1| hypothetical protein STEHIDRAFT_145511 [Ster... 57 2e-06 >ref|XP_007301378.1| hypothetical protein STEHIDRAFT_145511 [Stereum hirsutum FP-91666 SS1] gi|389749256|gb|EIM90433.1| hypothetical protein STEHIDRAFT_145511 [Stereum hirsutum FP-91666 SS1] Length = 207 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = -1 Query: 304 PVPPSLRDSPLLASPTSIFRTGYFPRRSAELDERWLMDTVPVP 176 PVPPSL SPLL SP S+FR Y R E DE+WL DTVP+P Sbjct: 43 PVPPSLAKSPLLLSPRSMFRRAYTTPRPNERDEQWLRDTVPLP 85