BLASTX nr result
ID: Paeonia23_contig00041039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041039 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007139198.1| hypothetical protein PHAVU_008G009500g [Phas... 56 5e-06 ref|XP_006383366.1| hypothetical protein POPTR_0005s14890g [Popu... 56 5e-06 >ref|XP_007139198.1| hypothetical protein PHAVU_008G009500g [Phaseolus vulgaris] gi|561012331|gb|ESW11192.1| hypothetical protein PHAVU_008G009500g [Phaseolus vulgaris] Length = 126 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 107 VDANLSVLRKRIEEVKIKQSMSGSCRHTYGWNYKSLENHKQK 232 +DANL+VL+KRIE VK+K+ + C+ GWNY SL NHK K Sbjct: 41 IDANLNVLKKRIEMVKVKERLERCCKSQNGWNYVSLSNHKTK 82 >ref|XP_006383366.1| hypothetical protein POPTR_0005s14890g [Populus trichocarpa] gi|550338975|gb|ERP61163.1| hypothetical protein POPTR_0005s14890g [Populus trichocarpa] Length = 130 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 98 SDIVDANLSVLRKRIEEVKIKQSMSGSCRHTYGWNYKSLENHK 226 S+ VDANLSVLR+RIEEVKI++ + CR YGWNY++ N+K Sbjct: 42 SNNVDANLSVLRERIEEVKIRERLERGCRCEYGWNYETGYNNK 84