BLASTX nr result
ID: Paeonia23_contig00040914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040914 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007294705.1| solute carrier family 25 protein [Marssonina... 109 5e-22 >ref|XP_007294705.1| solute carrier family 25 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862003|gb|EKD15055.1| solute carrier family 25 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 448 Score = 109 bits (272), Expect = 5e-22 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -1 Query: 230 PTAFDNFFASYQSPILMSTFAAQVCHYQYIRRTTPVVDGPSG-FARIASFPRPLRAGLGW 54 PTA D A YQSPILM TFA QV H+QYIRRTTP + S F R+AS PRPLRAGLGW Sbjct: 7 PTAMDKLCAKYQSPILMGTFALQVAHHQYIRRTTPTYEPLSSTFPRLASVPRPLRAGLGW 66 Query: 53 AAVFVGLLTQITLAKRT 3 AA+F+GLLTQITLAKR+ Sbjct: 67 AAIFLGLLTQITLAKRS 83