BLASTX nr result
ID: Paeonia23_contig00040647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040647 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77763.1| hypothetical protein VITISV_026761 [Vitis vinifera] 45 4e-06 >emb|CAN77763.1| hypothetical protein VITISV_026761 [Vitis vinifera] Length = 369 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 23/57 (40%), Positives = 32/57 (56%) Frame = -2 Query: 358 KSMGQEQEKYTLYCDSQNVIHVXXXXXXXXXXXHINVKYH*ICDVLKSKA*SSRKPH 188 + +G +QE+Y LYCDSQ+ IH+ HI+V+YH ICD + K K H Sbjct: 281 QELGLQQERYLLYCDSQSDIHLSKNSIFYSRFKHIDVRYHWICDSPEMKLFCLEKIH 337 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 192 HTNDNSSDMTTKSLPKKKHDTSRCVVVMFEPST 94 HT++N SDM TK +P +K R V + EP T Sbjct: 337 HTDENGSDMMTKPIPTEKIQFCRKQVGLVEPLT 369