BLASTX nr result
ID: Paeonia23_contig00040497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040497 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511863.1| CRP, putative [Ricinus communis] gi|22354904... 55 8e-06 >ref|XP_002511863.1| CRP, putative [Ricinus communis] gi|223549043|gb|EEF50532.1| CRP, putative [Ricinus communis] Length = 2264 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 6/63 (9%) Frame = -2 Query: 315 QYSSFHV------ISSSEDNSAQATSPGYLGHNVAKIVQAQDKTIICRDLRVAHKFLFES 154 QY SF I EDN A+A PGYL H+ AK VQA DK +I D++ A+ FLFE+ Sbjct: 472 QYQSFSFNQVVLSIQKREDNLAKAACPGYLVHSAAKAVQALDKALILGDIKEAYNFLFEN 531 Query: 153 IYD 145 D Sbjct: 532 FCD 534