BLASTX nr result
ID: Paeonia23_contig00040482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040482 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275246.1| PREDICTED: uncharacterized protein LOC100241... 102 4e-20 ref|XP_004306220.1| PREDICTED: uncharacterized protein LOC101302... 100 3e-19 gb|EXB93644.1| hypothetical protein L484_018030 [Morus notabilis] 98 1e-18 ref|XP_002322675.2| hypothetical protein POPTR_0016s04850g, part... 97 3e-18 ref|XP_007204430.1| hypothetical protein PRUPE_ppa1027152mg [Pru... 97 3e-18 ref|XP_007203103.1| hypothetical protein PRUPE_ppa023810mg, part... 97 3e-18 ref|XP_004234893.1| PREDICTED: uncharacterized protein LOC101249... 94 3e-17 ref|XP_002530356.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 ref|XP_007028957.1| Mitochondrial transcription termination fact... 91 2e-16 ref|XP_007028956.1| Mitochondrial transcription termination fact... 91 2e-16 ref|XP_004306104.1| PREDICTED: uncharacterized protein LOC101308... 91 2e-16 gb|EYU20705.1| hypothetical protein MIMGU_mgv1a0010911mg, partia... 90 4e-16 ref|XP_002530357.1| conserved hypothetical protein [Ricinus comm... 89 5e-16 ref|XP_006401415.1| hypothetical protein EUTSA_v10013107mg [Eutr... 87 3e-15 ref|XP_006399157.1| hypothetical protein EUTSA_v10012500mg [Eutr... 86 7e-15 ref|XP_003625242.1| hypothetical protein MTR_7g093000 [Medicago ... 84 2e-14 ref|XP_002530355.1| conserved hypothetical protein [Ricinus comm... 84 2e-14 ref|XP_002871231.1| predicted protein [Arabidopsis lyrata subsp.... 84 3e-14 ref|NP_196299.1| mitochondrial transcription termination factor ... 83 4e-14 ref|XP_002322676.2| hypothetical protein POPTR_0016s04860g [Popu... 83 4e-14 >ref|XP_002275246.1| PREDICTED: uncharacterized protein LOC100241837 [Vitis vinifera] gi|147864060|emb|CAN83222.1| hypothetical protein VITISV_031366 [Vitis vinifera] gi|297739852|emb|CBI30034.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 102 bits (255), Expect = 4e-20 Identities = 48/75 (64%), Positives = 63/75 (84%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 +NP+ELK WVLG RV PLPN +DL S++++T FL DLG+V+++KEI++A KLFRGKG E Sbjct: 404 DNPQELKKWVLGSRVGPLPNLGEDLRSQLQKTKFLSDLGYVENTKEIEKARKLFRGKGME 463 Query: 182 LQERFECCVKAGLDR 226 LQERF+ +KAGLDR Sbjct: 464 LQERFDFLMKAGLDR 478 >ref|XP_004306220.1| PREDICTED: uncharacterized protein LOC101302386 [Fragaria vesca subsp. vesca] Length = 1161 Score = 100 bits (248), Expect = 3e-19 Identities = 48/75 (64%), Positives = 59/75 (78%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPEELKNWV G RV+ PNS ++ S+ +RT FLLD+GFV++S ++K ALK RG G E Sbjct: 975 ENPEELKNWVWGRRVESFPNSGDEVRSKAQRTKFLLDIGFVENSNKMKAALKACRGNGVE 1034 Query: 182 LQERFECCVKAGLDR 226 LQERF+C VKAGLDR Sbjct: 1035 LQERFDCIVKAGLDR 1049 Score = 98.2 bits (243), Expect = 1e-18 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPE LK WVLG RV+PLP+SE+D S+ +R FLLD+GFV +S +++ ALKLFRGKGGE Sbjct: 406 ENPEALKKWVLGRRVEPLPDSEED--SKGKRVKFLLDVGFVANSNKMEVALKLFRGKGGE 463 Query: 182 LQERFECCVKAGLDR 226 LQ+RF C V AGL+R Sbjct: 464 LQDRFNCLVNAGLNR 478 >gb|EXB93644.1| hypothetical protein L484_018030 [Morus notabilis] Length = 578 Score = 97.8 bits (242), Expect = 1e-18 Identities = 47/75 (62%), Positives = 59/75 (78%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENP+ELKN VLG ++KP P E+DL+SE R FLLDLGFV+DS ++K A K+FRGKGG+ Sbjct: 395 ENPQELKNLVLGAKLKPFPRLEEDLASESLRNKFLLDLGFVQDSDKMKAAQKMFRGKGGK 454 Query: 182 LQERFECCVKAGLDR 226 LQERF+ + GLDR Sbjct: 455 LQERFDFIMSYGLDR 469 >ref|XP_002322675.2| hypothetical protein POPTR_0016s04850g, partial [Populus trichocarpa] gi|550320855|gb|EEF04436.2| hypothetical protein POPTR_0016s04850g, partial [Populus trichocarpa] Length = 612 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/75 (60%), Positives = 61/75 (81%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPE +K WV G +++ LP+S ++L S++ +T F LDLGFV++S E+KRALK+FRG+G E Sbjct: 450 ENPEIMKKWVKGSKIEWLPDSGEELRSQMLKTKFFLDLGFVENSDEMKRALKVFRGRGAE 509 Query: 182 LQERFECCVKAGLDR 226 LQERF+C V AGLDR Sbjct: 510 LQERFDCLVIAGLDR 524 >ref|XP_007204430.1| hypothetical protein PRUPE_ppa1027152mg [Prunus persica] gi|462399961|gb|EMJ05629.1| hypothetical protein PRUPE_ppa1027152mg [Prunus persica] Length = 588 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/75 (62%), Positives = 60/75 (80%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPEELKN VLG RV+PLP +E+D S+ ++ FLLD GFV++S ++ ALK+FRGKG E Sbjct: 404 ENPEELKNLVLGRRVEPLPAAEEDQISKAQKLEFLLDKGFVENSNKMTAALKVFRGKGTE 463 Query: 182 LQERFECCVKAGLDR 226 L+ERF+C V AGLDR Sbjct: 464 LKERFDCIVNAGLDR 478 >ref|XP_007203103.1| hypothetical protein PRUPE_ppa023810mg, partial [Prunus persica] gi|462398634|gb|EMJ04302.1| hypothetical protein PRUPE_ppa023810mg, partial [Prunus persica] Length = 594 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/75 (62%), Positives = 60/75 (80%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENP+ELKNWVLG RV P P+S ++ S+ +RT FLLD+GFV +S ++K+AL RGKGGE Sbjct: 409 ENPQELKNWVLGKRVDPFPSSGENRISKTQRTKFLLDIGFVDNSNKMKKAL---RGKGGE 465 Query: 182 LQERFECCVKAGLDR 226 LQERF+C VKAGL + Sbjct: 466 LQERFDCIVKAGLSQ 480 >ref|XP_004234893.1| PREDICTED: uncharacterized protein LOC101249531 [Solanum lycopersicum] Length = 565 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/75 (60%), Positives = 61/75 (81%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPE L+N V G +V+ LP +E++L S++ +T FLLDLGF ++S E+++ALKLFRGKG E Sbjct: 380 ENPEFLRNLVRGAKVERLPIAEEELRSKMMKTKFLLDLGFAENSSEMEKALKLFRGKGVE 439 Query: 182 LQERFECCVKAGLDR 226 LQERF+C V AGL+R Sbjct: 440 LQERFDCLVNAGLNR 454 >ref|XP_002530356.1| conserved hypothetical protein [Ricinus communis] gi|223530103|gb|EEF32017.1| conserved hypothetical protein [Ricinus communis] Length = 523 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/75 (56%), Positives = 62/75 (82%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 +NP+E+KNWV+G +V PLP+ E+ L S + + FLLDLGFV++S E+++ALK+FRG+G E Sbjct: 339 QNPQEMKNWVIGSKVNPLPSDER-LRSRMLKNKFLLDLGFVENSTEMEKALKVFRGRGAE 397 Query: 182 LQERFECCVKAGLDR 226 LQERF+ ++AGLD+ Sbjct: 398 LQERFDSIMEAGLDK 412 >ref|XP_007028957.1| Mitochondrial transcription termination factor family protein, putative isoform 2, partial [Theobroma cacao] gi|508717562|gb|EOY09459.1| Mitochondrial transcription termination factor family protein, putative isoform 2, partial [Theobroma cacao] Length = 586 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENP+EL WV+G RV LP+S +D+ S+ R FLLDLG+ ++ IK+ALK+FRG+GGE Sbjct: 399 ENPQELSKWVMGKRVVRLPDSGEDIKSQRLRMKFLLDLGYGENPNMIKKALKVFRGRGGE 458 Query: 182 LQERFECCVKAGLDR 226 LQERF+ V AGLD+ Sbjct: 459 LQERFDSIVNAGLDK 473 >ref|XP_007028956.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] gi|508717561|gb|EOY09458.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] Length = 586 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENP+EL WV+G RV LP+S +D+ S+ R FLLDLG+ ++ IK+ALK+FRG+GGE Sbjct: 399 ENPQELSKWVMGKRVVRLPDSGEDIKSQRLRMKFLLDLGYGENPNMIKKALKVFRGRGGE 458 Query: 182 LQERFECCVKAGLDR 226 LQERF+ V AGLD+ Sbjct: 459 LQERFDSIVNAGLDK 473 >ref|XP_004306104.1| PREDICTED: uncharacterized protein LOC101308703 [Fragaria vesca subsp. vesca] Length = 331 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 1/75 (1%) Frame = +2 Query: 2 ENPEELK-NWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGG 178 ENPEELK NWV G +V+ P+S ++ S+ +RT FLLD+GFV++S ++K ALK RG G Sbjct: 144 ENPEELKKNWVWGRKVESFPDSGDEVRSKAQRTKFLLDIGFVENSNKMKAALKACRGNGV 203 Query: 179 ELQERFECCVKAGLD 223 ELQERF+C VKAGLD Sbjct: 204 ELQERFDCIVKAGLD 218 >gb|EYU20705.1| hypothetical protein MIMGU_mgv1a0010911mg, partial [Mimulus guttatus] Length = 583 Score = 89.7 bits (221), Expect = 4e-16 Identities = 44/75 (58%), Positives = 56/75 (74%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 E+P LK WVLGVRV L + + L+ + + FL+ LGFV+DSKE++RALK+FRGKG E Sbjct: 397 EDPYVLKKWVLGVRVDRLQDPNRILNVRMMKIKFLISLGFVEDSKEMERALKVFRGKGEE 456 Query: 182 LQERFECCVKAGLDR 226 LQERF+C VK GL R Sbjct: 457 LQERFDCLVKLGLSR 471 >ref|XP_002530357.1| conserved hypothetical protein [Ricinus communis] gi|223530104|gb|EEF32018.1| conserved hypothetical protein [Ricinus communis] Length = 578 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/75 (54%), Positives = 58/75 (77%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 +NP E+KNWV+G ++ PLP+ L S I + FLLDLGFVK+S E+++ALK+F+G G E Sbjct: 398 QNPLEMKNWVIGSKINPLPSER--LRSRILKIKFLLDLGFVKNSIEMEKALKVFKGSGAE 455 Query: 182 LQERFECCVKAGLDR 226 L ERF+C ++AGLD+ Sbjct: 456 LHERFDCIMQAGLDK 470 >ref|XP_006401415.1| hypothetical protein EUTSA_v10013107mg [Eutrema salsugineum] gi|557102505|gb|ESQ42868.1| hypothetical protein EUTSA_v10013107mg [Eutrema salsugineum] Length = 572 Score = 86.7 bits (213), Expect = 3e-15 Identities = 36/74 (48%), Positives = 61/74 (82%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPEE+KNW +G++V+PLP++ ++ +S + +T FLL+LG+ ++S++++RA+K FRG+G E Sbjct: 392 ENPEEMKNWTMGLKVQPLPSTGEEETSRLMKTQFLLNLGYKENSEDMERAVKKFRGRGSE 451 Query: 182 LQERFECCVKAGLD 223 LQ+RF+ V GL+ Sbjct: 452 LQQRFDFLVSLGLN 465 >ref|XP_006399157.1| hypothetical protein EUTSA_v10012500mg [Eutrema salsugineum] gi|557100247|gb|ESQ40610.1| hypothetical protein EUTSA_v10012500mg [Eutrema salsugineum] Length = 1123 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/74 (51%), Positives = 56/74 (75%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPEE+K W +G +V+PLP++E + S+ +T FLLDLG+ ++S+E++RALK FRG+G E Sbjct: 387 ENPEEIKKWTMGSKVEPLPDTEGYMDSKAMKTQFLLDLGYKENSEEMERALKSFRGRGSE 446 Query: 182 LQERFECCVKAGLD 223 L+ERF V G + Sbjct: 447 LRERFNVLVSLGFN 460 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/73 (52%), Positives = 54/73 (73%) Frame = +2 Query: 5 NPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGEL 184 NPEE+K W+ G RV+PLP + D S+ + FLLDLG+ ++S+E++RALK FRG+G EL Sbjct: 939 NPEEMKKWIKGSRVQPLPGTGVDTKSKAMKIQFLLDLGYKENSEEMERALKSFRGRGSEL 998 Query: 185 QERFECCVKAGLD 223 +ERF+ V GL+ Sbjct: 999 RERFDFLVSLGLN 1011 >ref|XP_003625242.1| hypothetical protein MTR_7g093000 [Medicago truncatula] gi|355500257|gb|AES81460.1| hypothetical protein MTR_7g093000 [Medicago truncatula] Length = 571 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (2%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSE--KDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKG 175 +NP E+KNWVLG+RVKP+ ++ S + +T FLL LG+V+++KE+ A K FRGKG Sbjct: 383 DNPHEMKNWVLGIRVKPMVGLRDLEEEKSRVGKTEFLLRLGYVENTKEMDSAFKAFRGKG 442 Query: 176 GELQERFECCVKAGLDR 226 ELQERF+ V AGL R Sbjct: 443 AELQERFDFIVNAGLTR 459 >ref|XP_002530355.1| conserved hypothetical protein [Ricinus communis] gi|223530102|gb|EEF32016.1| conserved hypothetical protein [Ricinus communis] Length = 573 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/75 (52%), Positives = 59/75 (78%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENP+E+K W +G RV+ LP+S ++ S+ +T FL+D+G V + ++++ALK+FRG+G E Sbjct: 391 ENPQEMKRWEMGSRVERLPSSWEE--SKTLKTKFLVDMGLVNNLNKMEQALKVFRGRGTE 448 Query: 182 LQERFECCVKAGLDR 226 +QERF+C VKAGLDR Sbjct: 449 IQERFDCIVKAGLDR 463 >ref|XP_002871231.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297317068|gb|EFH47490.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1144 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/74 (54%), Positives = 56/74 (75%), Gaps = 2/74 (2%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNS--EKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKG 175 ENPEE+K W++G+RV+PLP + + D S+ +T FLLDLG+ ++S+E++RALK FRGKG Sbjct: 955 ENPEEMKKWIMGLRVQPLPATGCKVDTKSKTMKTQFLLDLGYKENSEEMERALKNFRGKG 1014 Query: 176 GELQERFECCVKAG 217 EL+ERF V G Sbjct: 1015 SELRERFNVLVSFG 1028 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/72 (48%), Positives = 53/72 (73%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 E+PEE+K W +G +++PLP + D+ S++ +T FLLDLG+ ++S+E++ ALK FRGK E Sbjct: 401 ESPEEMKKWTMGSKIQPLPATNVDIDSKLMKTQFLLDLGYKENSEEMESALKNFRGKRSE 460 Query: 182 LQERFECCVKAG 217 L+ERF V G Sbjct: 461 LRERFNVLVSLG 472 >ref|NP_196299.1| mitochondrial transcription termination factor family protein [Arabidopsis thaliana] gi|9759310|dbj|BAB09816.1| unnamed protein product [Arabidopsis thaliana] gi|332003686|gb|AED91069.1| mitochondrial transcription termination factor family protein [Arabidopsis thaliana] Length = 1141 Score = 83.2 bits (204), Expect = 4e-14 Identities = 40/75 (53%), Positives = 57/75 (76%), Gaps = 2/75 (2%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNS--EKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKG 175 ENPEE+K W++G+RV+PLP + + + S+ +T FLLDLG+ ++S+E++RALK FRGKG Sbjct: 955 ENPEEMKKWIMGLRVQPLPATGYKVNTKSKTMKTQFLLDLGYKENSEEMERALKNFRGKG 1014 Query: 176 GELQERFECCVKAGL 220 EL+ERF V GL Sbjct: 1015 SELRERFNVLVSFGL 1029 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/75 (48%), Positives = 54/75 (72%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 ENPEE+K W +G +++PLP + D+ S+ +T FLLDLG+ ++S+E++ A+K FRGKG E Sbjct: 400 ENPEEMKKWTMGSKIQPLPATNVDIESKSMKTQFLLDLGYKENSEEMETAMKNFRGKGSE 459 Query: 182 LQERFECCVKAGLDR 226 L+ERF V G + Sbjct: 460 LRERFNVLVSLGFTK 474 >ref|XP_002322676.2| hypothetical protein POPTR_0016s04860g [Populus trichocarpa] gi|550320856|gb|EEF04437.2| hypothetical protein POPTR_0016s04860g [Populus trichocarpa] Length = 567 Score = 83.2 bits (204), Expect = 4e-14 Identities = 41/75 (54%), Positives = 55/75 (73%) Frame = +2 Query: 2 ENPEELKNWVLGVRVKPLPNSEKDLSSEIERTNFLLDLGFVKDSKEIKRALKLFRGKGGE 181 E+P+ LK WV+G +V+ L N L S +++T FLLDLG V DS EI +ALK+FRG G + Sbjct: 384 ESPQVLKKWVMGSKVERLQNLI--LKSRMQKTKFLLDLGIVDDSNEIGKALKVFRGSGAK 441 Query: 182 LQERFECCVKAGLDR 226 +QERF+C V+AGL R Sbjct: 442 IQERFDCIVEAGLSR 456