BLASTX nr result
ID: Paeonia23_contig00040247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040247 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565182.1| sodium Bile acid symporter family [Arabidopsis ... 73 5e-11 gb|AAD30581.1|AC007260_12 similar to SRG1 protein [Arabidopsis t... 73 5e-11 gb|EXB74716.1| putative sodium-dependent transporter yocS [Morus... 72 8e-11 gb|EXB74714.1| putative sodium-dependent transporter yocS [Morus... 72 8e-11 ref|XP_002889199.1| bile acid:sodium symporter family protein [A... 72 8e-11 ref|XP_006367653.1| PREDICTED: probable sodium/metabolite cotran... 72 1e-10 ref|XP_004251493.1| PREDICTED: probable sodium/metabolite cotran... 72 1e-10 ref|XP_007211859.1| hypothetical protein PRUPE_ppa010017mg [Prun... 71 2e-10 ref|XP_006389975.1| hypothetical protein EUTSA_v10018656mg [Eutr... 70 3e-10 ref|XP_002283695.1| PREDICTED: uncharacterized sodium-dependent ... 70 3e-10 emb|CBI20100.3| unnamed protein product [Vitis vinifera] 70 3e-10 emb|CAN63237.1| hypothetical protein VITISV_023946 [Vitis vinifera] 70 3e-10 ref|XP_007022021.1| Sodium Bile acid symporter family isoform 1 ... 69 5e-10 ref|XP_006477810.1| PREDICTED: probable sodium/metabolite cotran... 69 7e-10 ref|XP_006442338.1| hypothetical protein CICLE_v10020318mg [Citr... 69 7e-10 gb|EYU38235.1| hypothetical protein MIMGU_mgv1a007506mg [Mimulus... 69 9e-10 ref|XP_004294172.1| PREDICTED: probable sodium/metabolite cotran... 69 9e-10 ref|XP_002531245.1| sodium-bile acid cotransporter, putative [Ri... 69 9e-10 ref|XP_004488981.1| PREDICTED: probable sodium/metabolite cotran... 66 6e-09 ref|XP_006301266.1| hypothetical protein CARUB_v10021666mg [Caps... 65 8e-09 >ref|NP_565182.1| sodium Bile acid symporter family [Arabidopsis thaliana] gi|75163651|sp|Q93YR2.1|BASS1_ARATH RecName: Full=Probable sodium/metabolite cotransporter BASS1, chloroplastic; AltName: Full=Bile acid transporter 2; AltName: Full=Bile acid-sodium symporter family protein 1; Flags: Precursor gi|16648877|gb|AAL24290.1| Unknown protein [Arabidopsis thaliana] gi|21593677|gb|AAM65644.1| unknown [Arabidopsis thaliana] gi|23197632|gb|AAN15343.1| Unknown protein [Arabidopsis thaliana] gi|332198000|gb|AEE36121.1| sodium Bile acid symporter family [Arabidopsis thaliana] Length = 401 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI+GSVLAG WRR+ P Q++D Sbjct: 364 FGNPLTAVPCAVSSVCHSILGSVLAGIWRRSAPKQLED 401 >gb|AAD30581.1|AC007260_12 similar to SRG1 protein [Arabidopsis thaliana] Length = 184 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI+GSVLAG WRR+ P Q++D Sbjct: 147 FGNPLTAVPCAVSSVCHSILGSVLAGIWRRSAPKQLED 184 >gb|EXB74716.1| putative sodium-dependent transporter yocS [Morus notabilis] Length = 179 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI GSVLAG WR+ VP+Q QD Sbjct: 142 FGNPLTAVPCAVSSVCHSIFGSVLAGIWRQNVPTQTQD 179 >gb|EXB74714.1| putative sodium-dependent transporter yocS [Morus notabilis] Length = 403 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI GSVLAG WR+ VP+Q QD Sbjct: 366 FGNPLTAVPCAVSSVCHSIFGSVLAGIWRQNVPTQTQD 403 >ref|XP_002889199.1| bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297335040|gb|EFH65458.1| bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata] Length = 399 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI+GS LAG WRR+ P QI+D Sbjct: 362 FGNPLTAVPCAVSSVCHSILGSALAGIWRRSAPKQIED 399 >ref|XP_006367653.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like [Solanum tuberosum] Length = 412 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI GS LAG WRR++P ++QD Sbjct: 375 FGNPLTAVPCAVSSVCHSIFGSALAGIWRRSIPDKVQD 412 >ref|XP_004251493.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like [Solanum lycopersicum] Length = 408 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI GS LAG WRR++P ++QD Sbjct: 371 FGNPLTAVPCAVSSVCHSIFGSALAGIWRRSIPDKVQD 408 >ref|XP_007211859.1| hypothetical protein PRUPE_ppa010017mg [Prunus persica] gi|462407724|gb|EMJ13058.1| hypothetical protein PRUPE_ppa010017mg [Prunus persica] Length = 267 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI+GS LAG WR++VP+Q QD Sbjct: 230 FGNPLTAVPCAVSSVCHSILGSALAGIWRQSVPTQKQD 267 >ref|XP_006389975.1| hypothetical protein EUTSA_v10018656mg [Eutrema salsugineum] gi|557086409|gb|ESQ27261.1| hypothetical protein EUTSA_v10018656mg [Eutrema salsugineum] Length = 402 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI+GS+LAG WRR+ P QI++ Sbjct: 365 FGNPLTAVPCAVSSVCHSILGSMLAGVWRRSAPKQIEN 402 >ref|XP_002283695.1| PREDICTED: uncharacterized sodium-dependent transporter yocS-like [Vitis vinifera] Length = 420 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHS+ GSVLAG WRR+ P ++QD Sbjct: 383 FGNPLTAVPCAVSSVCHSVFGSVLAGIWRRSPPVKVQD 420 >emb|CBI20100.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHS+ GSVLAG WRR+ P ++QD Sbjct: 146 FGNPLTAVPCAVSSVCHSVFGSVLAGIWRRSPPVKVQD 183 >emb|CAN63237.1| hypothetical protein VITISV_023946 [Vitis vinifera] Length = 177 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHS+ GSVLAG WRR+ P ++QD Sbjct: 140 FGNPLTAVPCAVSSVCHSVFGSVLAGIWRRSPPVKVQD 177 >ref|XP_007022021.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao] gi|508721649|gb|EOY13546.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao] Length = 404 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 F NPLTAVPCAVSSVCHSI GS+LAG WRRTVP Q Q+ Sbjct: 367 FQNPLTAVPCAVSSVCHSIFGSILAGIWRRTVPKQKQE 404 >ref|XP_006477810.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like [Citrus sinensis] Length = 420 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FG+PL AVPCAVSSVCHSI GSVLAG WRR+ P Q+QD Sbjct: 383 FGSPLAAVPCAVSSVCHSIFGSVLAGIWRRSTPKQMQD 420 >ref|XP_006442338.1| hypothetical protein CICLE_v10020318mg [Citrus clementina] gi|557544600|gb|ESR55578.1| hypothetical protein CICLE_v10020318mg [Citrus clementina] Length = 420 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FG+PL AVPCAVSSVCHSI GSVLAG WRR+ P Q+QD Sbjct: 383 FGSPLAAVPCAVSSVCHSIFGSVLAGIWRRSTPKQMQD 420 >gb|EYU38235.1| hypothetical protein MIMGU_mgv1a007506mg [Mimulus guttatus] Length = 405 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHSI GS LAG WRR++P+ Q+ Sbjct: 365 FGNPLTAVPCAVSSVCHSIFGSALAGIWRRSIPTNTQE 402 >ref|XP_004294172.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 405 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQ 163 FGNPLTAVPCAVSSVCHSIIGS LAG WRR+VP + Sbjct: 369 FGNPLTAVPCAVSSVCHSIIGSALAGIWRRSVPKE 403 >ref|XP_002531245.1| sodium-bile acid cotransporter, putative [Ricinus communis] gi|223529164|gb|EEF31142.1| sodium-bile acid cotransporter, putative [Ricinus communis] Length = 404 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FGNPLTAVPCAVSSVCHS+ GS+LAG WRR++P+Q +D Sbjct: 367 FGNPLTAVPCAVSSVCHSVFGSLLAGVWRRSLPTQNKD 404 >ref|XP_004488981.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like [Cicer arietinum] Length = 400 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FG+PLT VPCAVSSVCHSI GS+LAG WRR VP +++D Sbjct: 363 FGDPLTTVPCAVSSVCHSIYGSILAGMWRRHVPPEMKD 400 >ref|XP_006301266.1| hypothetical protein CARUB_v10021666mg [Capsella rubella] gi|482569976|gb|EOA34164.1| hypothetical protein CARUB_v10021666mg [Capsella rubella] Length = 401 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 267 FGNPLTAVPCAVSSVCHSIIGSVLAGFWRRTVPSQIQD 154 FG+PLTAVPCAVSSVCHSI+GSVLAG WR + P Q+++ Sbjct: 364 FGDPLTAVPCAVSSVCHSILGSVLAGIWRLSSPKQLEN 401