BLASTX nr result
ID: Paeonia23_contig00040199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040199 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] 62 1e-07 ref|XP_002309173.2| pentatricopeptide repeat-containing family p... 59 5e-07 ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Vitis vinifera] Length = 505 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 142 RSPVKSTCNLLRKRRKWPQSPYKAKWHETFNQQEAMRTLK 261 R P S N LRKRRKWP SPYKA WHETF+ ++AM+TLK Sbjct: 3 RPPSFSKTNFLRKRRKWPLSPYKATWHETFHHRQAMQTLK 42 >emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] Length = 390 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 142 RSPVKSTCNLLRKRRKWPQSPYKAKWHETFNQQEAMRTLK 261 R P S N LRKRRKWP SPYKA WHETF+ ++AM+TLK Sbjct: 5 RPPSFSKTNFLRKRRKWPLSPYKATWHETFHHRQAMQTLK 44 >ref|XP_002309173.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335936|gb|EEE92696.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 490 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 154 KSTCNLLRKRRKWPQSPYKAKWHETFNQQEAMRTLKQ 264 KS LRK RKWP SPYKA+WH FNQQ+AM++LKQ Sbjct: 8 KSASFFLRKHRKWPYSPYKARWHRIFNQQQAMQSLKQ 44 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 145 SPVKSTCNLLRKRRKWPQSPYKAKWHETFNQQEAMRTLKQ 264 S VK + N LRK RKWP S +K KWH+TF+Q EA+R LKQ Sbjct: 6 SVVKKSNNFLRKHRKWPLSSHKTKWHQTFDQDEALRILKQ 45