BLASTX nr result
ID: Paeonia23_contig00040180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00040180 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] g... 110 2e-22 ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] g... 110 2e-22 ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prun... 110 2e-22 gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] 110 2e-22 gb|AEZ00848.1| putative cullin protein, partial [Elaeis guineensis] 110 3e-22 ref|XP_006444260.1| hypothetical protein CICLE_v10019010mg [Citr... 109 4e-22 ref|XP_006396468.1| hypothetical protein EUTSA_v10028463mg [Eutr... 109 4e-22 ref|XP_006289774.1| hypothetical protein CARUB_v10003375mg [Caps... 109 4e-22 ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prun... 109 4e-22 emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] 109 4e-22 dbj|BAD95380.1| putative cullin-like 1 protein [Arabidopsis thal... 109 4e-22 ref|NP_567243.1| cullin 1 [Arabidopsis thaliana] gi|79324981|ref... 109 4e-22 gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] 109 4e-22 ref|XP_002874909.1| ATCUL1 [Arabidopsis lyrata subsp. lyrata] gi... 109 4e-22 ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223... 109 4e-22 gb|AAC78267.1| putative cullin-like 1 protein [Arabidopsis thali... 109 4e-22 ref|XP_006359412.1| PREDICTED: cullin-1-like [Solanum tuberosum] 109 5e-22 ref|XP_006352809.1| PREDICTED: cullin-1-like [Solanum tuberosum] 109 5e-22 ref|XP_006368709.1| hypothetical protein POPTR_0001s07990g [Popu... 109 5e-22 ref|XP_004309677.1| PREDICTED: cullin-1-like [Fragaria vesca sub... 109 5e-22 >ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] gi|550328945|gb|EEF00624.2| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 110 bits (276), Expect = 2e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDKENPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] gi|550333694|gb|ERP57970.1| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 110 bits (276), Expect = 2e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDKENPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] gi|462394398|gb|EMJ00197.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] Length = 738 Score = 110 bits (275), Expect = 2e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP++K +K+RIEDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNMFKYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] Length = 738 Score = 110 bits (275), Expect = 2e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP++K +K+RIEDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNMFKYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >gb|AEZ00848.1| putative cullin protein, partial [Elaeis guineensis] Length = 91 Score = 110 bits (274), Expect = 3e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL++MFKP+ K +K+RIEDL+TRDYLERDK+NPNLF YL Sbjct: 31 VRIMKSRKVLGHQQLVLECVEQLNRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFRYL 90 Query: 115 A 113 A Sbjct: 91 A 91 >ref|XP_006444260.1| hypothetical protein CICLE_v10019010mg [Citrus clementina] gi|568852469|ref|XP_006479898.1| PREDICTED: cullin-1-like [Citrus sinensis] gi|557546522|gb|ESR57500.1| hypothetical protein CICLE_v10019010mg [Citrus clementina] Length = 738 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >ref|XP_006396468.1| hypothetical protein EUTSA_v10028463mg [Eutrema salsugineum] gi|567161465|ref|XP_006396469.1| hypothetical protein EUTSA_v10028463mg [Eutrema salsugineum] gi|557097485|gb|ESQ37921.1| hypothetical protein EUTSA_v10028463mg [Eutrema salsugineum] gi|557097486|gb|ESQ37922.1| hypothetical protein EUTSA_v10028463mg [Eutrema salsugineum] Length = 739 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 679 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 738 Query: 115 A 113 A Sbjct: 739 A 739 >ref|XP_006289774.1| hypothetical protein CARUB_v10003375mg [Capsella rubella] gi|482558480|gb|EOA22672.1| hypothetical protein CARUB_v10003375mg [Capsella rubella] Length = 738 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] gi|462423928|gb|EMJ28191.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] Length = 744 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDK+NPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] Length = 744 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDK+NPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >dbj|BAD95380.1| putative cullin-like 1 protein [Arabidopsis thaliana] Length = 248 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 188 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 247 Query: 115 A 113 A Sbjct: 248 A 248 >ref|NP_567243.1| cullin 1 [Arabidopsis thaliana] gi|79324981|ref|NP_001031575.1| cullin 1 [Arabidopsis thaliana] gi|79324983|ref|NP_001031576.1| cullin 1 [Arabidopsis thaliana] gi|334186321|ref|NP_001190661.1| cullin 1 [Arabidopsis thaliana] gi|68052236|sp|Q94AH6.1|CUL1_ARATH RecName: Full=Cullin-1 gi|15028161|gb|AAK76704.1| putative cullin 1 protein [Arabidopsis thaliana] gi|22136936|gb|AAM91812.1| putative cullin 1 protein [Arabidopsis thaliana] gi|30524960|emb|CAC85264.1| cullin 1 [Arabidopsis thaliana] gi|222423687|dbj|BAH19810.1| AT4G02570 [Arabidopsis thaliana] gi|332656794|gb|AEE82194.1| cullin 1 [Arabidopsis thaliana] gi|332656795|gb|AEE82195.1| cullin 1 [Arabidopsis thaliana] gi|332656796|gb|AEE82196.1| cullin 1 [Arabidopsis thaliana] gi|332656797|gb|AEE82197.1| cullin 1 [Arabidopsis thaliana] Length = 738 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] Length = 744 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDK+NPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >ref|XP_002874909.1| ATCUL1 [Arabidopsis lyrata subsp. lyrata] gi|297320746|gb|EFH51168.1| ATCUL1 [Arabidopsis lyrata subsp. lyrata] Length = 738 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 678 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 737 Query: 115 A 113 A Sbjct: 738 A 738 >ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223543987|gb|EEF45513.1| Cullin-1, putative [Ricinus communis] Length = 744 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP+ K +K+RIEDL+TRDYLERDK+NPNLF YL Sbjct: 684 VRIMKSRKVLGHQQLVLECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFRYL 743 Query: 115 A 113 A Sbjct: 744 A 744 >gb|AAC78267.1| putative cullin-like 1 protein [Arabidopsis thaliana] gi|7269017|emb|CAB80750.1| putative cullin-like 1 protein [Arabidopsis thaliana] Length = 676 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV ECVEQLS+MFKP++K +K+R+EDL+TRDYLERDKENPN+F YL Sbjct: 616 VRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYL 675 Query: 115 A 113 A Sbjct: 676 A 676 >ref|XP_006359412.1| PREDICTED: cullin-1-like [Solanum tuberosum] Length = 739 Score = 109 bits (272), Expect = 5e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVL HQQLV+ECVEQLS+MFKP+ K +K+RIEDL+TRDYLERDKENPNLF YL Sbjct: 679 VRIMKSRKVLPHQQLVLECVEQLSRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFKYL 738 Query: 115 A 113 A Sbjct: 739 A 739 >ref|XP_006352809.1| PREDICTED: cullin-1-like [Solanum tuberosum] Length = 740 Score = 109 bits (272), Expect = 5e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVL HQQLV+ECVEQLS+MFKP+ K +K+RIEDL+TRDYLERDKENPNLF YL Sbjct: 680 VRIMKSRKVLPHQQLVLECVEQLSRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFKYL 739 Query: 115 A 113 A Sbjct: 740 A 740 >ref|XP_006368709.1| hypothetical protein POPTR_0001s07990g [Populus trichocarpa] gi|550346796|gb|ERP65278.1| hypothetical protein POPTR_0001s07990g [Populus trichocarpa] Length = 737 Score = 109 bits (272), Expect = 5e-22 Identities = 49/61 (80%), Positives = 59/61 (96%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL++MFKP++K +K+RIEDL++RDYLERDKENPN+F YL Sbjct: 677 VRIMKSRKVLGHQQLVMECVEQLTRMFKPDIKAIKKRIEDLISRDYLERDKENPNMFRYL 736 Query: 115 A 113 A Sbjct: 737 A 737 >ref|XP_004309677.1| PREDICTED: cullin-1-like [Fragaria vesca subsp. vesca] Length = 738 Score = 109 bits (272), Expect = 5e-22 Identities = 50/61 (81%), Positives = 57/61 (93%) Frame = -3 Query: 295 VRIMKSRKVLGHQQLVVECVEQLSKMFKPEMKTVKRRIEDLVTRDYLERDKENPNLFNYL 116 VRIMKSRKVLGHQQLV+ECVEQL +MFKP++K +K+RIEDL+TRDYLERDKENPN F YL Sbjct: 678 VRIMKSRKVLGHQQLVMECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNTFKYL 737 Query: 115 A 113 A Sbjct: 738 A 738