BLASTX nr result
ID: Paeonia23_contig00039879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039879 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006450610.1| hypothetical protein CICLE_v10009982mg [Citr... 65 7e-09 ref|XP_007012027.1| Uncharacterized protein TCM_037131 [Theobrom... 64 3e-08 gb|EYU21885.1| hypothetical protein MIMGU_mgv1a020964mg [Mimulus... 56 5e-06 ref|XP_002516585.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_006450610.1| hypothetical protein CICLE_v10009982mg [Citrus clementina] gi|557553836|gb|ESR63850.1| hypothetical protein CICLE_v10009982mg [Citrus clementina] Length = 108 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 8/91 (8%) Frame = +1 Query: 31 MGLRKWYKYNSGT-SANETIYLGRCNTQNSSDSSDVHNKFQMIWRRIKREKK-------T 186 MGL+ W K G SA E I LGRC +Q+ S + +++++ IWR+I R +K Sbjct: 1 MGLKMWRKSGGGCGSAGEAIKLGRCYSQHQS--KEFNSRWRTIWRKITRGEKKKVHQSPV 58 Query: 187 TSSNSYNPETYLRNFDRESGRGEADNMCRSF 279 T Y+P+TY +NFD+ +G E DN+ RSF Sbjct: 59 TFQGYYDPDTYSQNFDQGTGSMEPDNLYRSF 89 >ref|XP_007012027.1| Uncharacterized protein TCM_037131 [Theobroma cacao] gi|508782390|gb|EOY29646.1| Uncharacterized protein TCM_037131 [Theobroma cacao] Length = 160 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 6/89 (6%) Frame = +1 Query: 31 MGLRKWYKYNSGTSANETIYLGRCNTQNSSDSSDVHNKFQMIWRRIKREKKTTSSN---- 198 M ++ W+++NSG ETI LGR +Q D+S K++ W++ +RE+K S+ Sbjct: 1 MEIKVWHRHNSG---RETITLGRSYSQRGKDAS--RPKWRTFWKKFRRERKKIFSSPVAF 55 Query: 199 --SYNPETYLRNFDRESGRGEADNMCRSF 279 SY+P+ Y +NFD+ +G E DN+ RSF Sbjct: 56 QASYDPDEYSQNFDQGTGWAEPDNLSRSF 84 >gb|EYU21885.1| hypothetical protein MIMGU_mgv1a020964mg [Mimulus guttatus] Length = 109 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 9/83 (10%) Frame = +1 Query: 58 NSGTSANETIYLGRCNTQNSSDSSDVHNKFQMIWRRIKREKKTTSSNS---------YNP 210 N + ++++ LG+ Q + S + K+ M WRR KR KK SS++ Y+P Sbjct: 5 NWKNTRSKSVRLGQNYMQTEHEHSSNY-KWLMFWRRTKRGKKNKSSDNSPLAAMQKTYDP 63 Query: 211 ETYLRNFDRESGRGEADNMCRSF 279 +TYL+NFD SGR E DN+ RSF Sbjct: 64 QTYLQNFDEGSGRIEPDNLYRSF 86 >ref|XP_002516585.1| conserved hypothetical protein [Ricinus communis] gi|223544405|gb|EEF45926.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 13/84 (15%) Frame = +1 Query: 67 TSANETIYLGRCNTQNSSDSSDVHN------KFQMIWRRIKREKKTTSSN-------SYN 207 +S ETIYLGR + + + + +N + +WRRI REKK S+ SY+ Sbjct: 11 SSYRETIYLGRNQSHKAKEEAHPNNINNNKWAWHRLWRRISREKKKIFSSVPVTLQASYD 70 Query: 208 PETYLRNFDRESGRGEADNMCRSF 279 P+ Y +NFD +G E DN+ RSF Sbjct: 71 PQEYHQNFDHGTGWTEPDNLSRSF 94