BLASTX nr result
ID: Paeonia23_contig00039874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039874 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_381257.1| hypothetical protein FG01081.1 [Fusarium gramin... 119 4e-25 gb|EQL04255.1| Ribosomal protein L5 [Ophiocordyceps sinensis CO18] 119 4e-25 emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [C... 119 4e-25 gb|EGU80777.1| hypothetical protein FOXB_08644 [Fusarium oxyspor... 119 4e-25 gb|EFY88628.1| 60S ribosomal protein L11 [Metarhizium acridum CQ... 119 4e-25 emb|CCE35372.1| probable ribosomal protein L11.e.A, cytosolic [C... 118 1e-24 gb|EJP70525.1| 60S ribosomal protein L11 [Beauveria bassiana ARS... 117 2e-24 ref|XP_006963013.1| 60S ribosomal protein L11, L5 family [Tricho... 117 2e-24 gb|ETS88104.1| 60S ribosomal protein L11 [Pestalotiopsis fici W1... 115 5e-24 gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderm... 115 5e-24 ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematoco... 115 5e-24 gb|EHK50062.1| hypothetical protein TRIATDRAFT_297405 [Trichoder... 115 8e-24 ref|XP_003712966.1| 60S ribosomal protein L11 [Magnaporthe oryza... 114 1e-23 ref|XP_007593026.1| ribosomal L5P family protein [Colletotrichum... 113 2e-23 emb|CCF38017.1| 60S ribosomal protein L11 [Colletotrichum higgin... 113 2e-23 ref|XP_006671375.1| 60S ribosomal protein L11 [Cordyceps militar... 113 2e-23 ref|XP_001913063.1| hypothetical protein [Podospora anserina S m... 113 2e-23 gb|EON97812.1| putative 60s ribosomal protein l11 protein [Togni... 112 5e-23 ref|XP_003652525.1| 60S ribosomal protein L11 [Thielavia terrest... 112 5e-23 ref|XP_006697554.1| putative ribosomal protein [Chaetomium therm... 112 5e-23 >ref|XP_381257.1| hypothetical protein FG01081.1 [Fusarium graminearum PH-1] gi|408390025|gb|EKJ69441.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096] gi|558856273|gb|ESU06356.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1] gi|596554680|gb|EYB33769.1| hypothetical protein FG05_01081 [Fusarium graminearum] Length = 173 Score = 119 bits (298), Expect = 4e-25 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EQL04255.1| Ribosomal protein L5 [Ophiocordyceps sinensis CO18] Length = 173 Score = 119 bits (298), Expect = 4e-25 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 20.1] Length = 173 Score = 119 bits (298), Expect = 4e-25 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EGU80777.1| hypothetical protein FOXB_08644 [Fusarium oxysporum Fo5176] gi|475664383|gb|EMT62178.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense race 4] gi|477507500|gb|ENH60794.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense race 1] gi|517310792|emb|CCT62200.1| probable ribosomal protein L11.e.A, cytosolic [Fusarium fujikuroi IMI 58289] gi|584128268|gb|EWG37687.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600] gi|584128269|gb|EWG37688.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600] gi|587671880|gb|EWY94221.1| 60S ribosomal protein L11 [Fusarium oxysporum FOSC 3-a] gi|587703883|gb|EWZ50488.1| 60S ribosomal protein L11 [Fusarium oxysporum Fo47] gi|587720712|gb|EWZ92049.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755594|gb|EXA53310.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. pisi HDV247] gi|590045863|gb|EXK47721.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. melonis 26406] gi|590062357|gb|EXK89881.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. raphani 54005] gi|591414281|gb|EXL49418.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591451205|gb|EXL83529.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479832|gb|EXM10892.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591498787|gb|EXM28225.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 173 Score = 119 bits (298), Expect = 4e-25 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EFY88628.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102] gi|322708627|gb|EFZ00204.1| 60S ribosomal protein L11 [Metarhizium anisopliae ARSEF 23] gi|594719772|gb|EXV02661.1| 60S ribosomal protein L11 [Metarhizium robertsii] Length = 173 Score = 119 bits (298), Expect = 4e-25 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >emb|CCE35372.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 20.1] Length = 173 Score = 118 bits (295), Expect = 1e-24 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSSEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EJP70525.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860] Length = 173 Score = 117 bits (293), Expect = 2e-24 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKANNPMRELKIQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKANNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_006963013.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a] gi|340521315|gb|EGR51550.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a] gi|572281330|gb|ETS04354.1| 60S ribosomal protein L11 [Trichoderma reesei RUT C-30] Length = 173 Score = 117 bits (293), Expect = 2e-24 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEKA+NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKASNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|ETS88104.1| 60S ribosomal protein L11 [Pestalotiopsis fici W106-1] Length = 173 Score = 115 bits (289), Expect = 5e-24 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEKA NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSSEKAQNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderma virens Gv29-8] Length = 173 Score = 115 bits (289), Expect = 5e-24 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEK +NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKTSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematococca mpVI 77-13-4] gi|256735139|gb|EEU48485.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 173 Score = 115 bits (289), Expect = 5e-24 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEK +NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKTSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EHK50062.1| hypothetical protein TRIATDRAFT_297405 [Trichoderma atroviride IMI 206040] Length = 173 Score = 115 bits (287), Expect = 8e-24 Identities = 58/61 (95%), Positives = 61/61 (100%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MA+EK++NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MATEKSSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_003712966.1| 60S ribosomal protein L11 [Magnaporthe oryzae 70-15] gi|291195830|gb|ADD84631.1| Rpl11ap [Magnaporthe oryzae] gi|351645298|gb|EHA53159.1| 60S ribosomal protein L11 [Magnaporthe oryzae 70-15] gi|440475688|gb|ELQ44353.1| 60S ribosomal protein L11 [Magnaporthe oryzae Y34] gi|440479843|gb|ELQ60582.1| 60S ribosomal protein L11 [Magnaporthe oryzae P131] Length = 173 Score = 114 bits (285), Expect = 1e-23 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEK NPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSSEKTQNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_007593026.1| ribosomal L5P family protein [Colletotrichum fioriniae PJ7] gi|588903161|gb|EXF83340.1| ribosomal L5P family protein [Colletotrichum fioriniae PJ7] Length = 173 Score = 113 bits (283), Expect = 2e-23 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEKA NPMREL IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSSEKAQNPMRELHIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >emb|CCF38017.1| 60S ribosomal protein L11 [Colletotrichum higginsianum] Length = 173 Score = 113 bits (283), Expect = 2e-23 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEKA NPMREL IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSSEKAQNPMRELHIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_006671375.1| 60S ribosomal protein L11 [Cordyceps militaris CM01] gi|346322412|gb|EGX92011.1| 60S ribosomal protein L11 [Cordyceps militaris CM01] Length = 173 Score = 113 bits (283), Expect = 2e-23 Identities = 58/61 (95%), Positives = 58/61 (95%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 MASEK NPMRELKIQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MASEKTGNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >ref|XP_001913063.1| hypothetical protein [Podospora anserina S mat+] gi|170948381|emb|CAP60545.1| unnamed protein product [Podospora anserina S mat+] Length = 173 Score = 113 bits (283), Expect = 2e-23 Identities = 57/61 (93%), Positives = 60/61 (98%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M++EKA NPMREL+IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI Sbjct: 1 MSAEKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 60 Query: 222 R 224 R Sbjct: 61 R 61 >gb|EON97812.1| putative 60s ribosomal protein l11 protein [Togninia minima UCRPA7] Length = 172 Score = 112 bits (280), Expect = 5e-23 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = +3 Query: 48 SEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR 224 SEKA NPMREL+IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR Sbjct: 2 SEKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR 60 >ref|XP_003652525.1| 60S ribosomal protein L11 [Thielavia terrestris NRRL 8126] gi|346999787|gb|AEO66189.1| hypothetical protein THITE_67248 [Thielavia terrestris NRRL 8126] Length = 172 Score = 112 bits (280), Expect = 5e-23 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = +3 Query: 48 SEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR 224 SEKA NPMREL+IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR Sbjct: 2 SEKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR 60 >ref|XP_006697554.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340897382|gb|EGS16972.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 173 Score = 112 bits (280), Expect = 5e-23 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +3 Query: 42 MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI 221 M+SEKA NPMREL+IQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVR FGI Sbjct: 1 MSSEKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRQFGI 60 Query: 222 R 224 R Sbjct: 61 R 61