BLASTX nr result
ID: Paeonia23_contig00039770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039770 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006441781.1| hypothetical protein CICLE_v10023084mg [Citr... 60 4e-07 ref|XP_006478342.1| PREDICTED: filamin A-interacting protein 1-l... 59 5e-07 ref|XP_002521745.1| hypothetical protein RCOM_1329260 [Ricinus c... 57 3e-06 >ref|XP_006441781.1| hypothetical protein CICLE_v10023084mg [Citrus clementina] gi|557544043|gb|ESR55021.1| hypothetical protein CICLE_v10023084mg [Citrus clementina] Length = 89 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 2 YLQSLHYQIEKLKGISHMIKCACGEEYKVDVGLRA 106 YLQSL +QIEKL+GISH+IKCACG+EYKV V L A Sbjct: 55 YLQSLQHQIEKLEGISHVIKCACGQEYKVKVSLSA 89 >ref|XP_006478342.1| PREDICTED: filamin A-interacting protein 1-like [Citrus sinensis] Length = 283 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 2 YLQSLHYQIEKLKGISHMIKCACGEEYKVDVGLRA 106 YLQSL +QIEKL+GISH+IKC CG+EYKV+V L A Sbjct: 249 YLQSLQHQIEKLEGISHVIKCVCGQEYKVEVSLSA 283 >ref|XP_002521745.1| hypothetical protein RCOM_1329260 [Ricinus communis] gi|223538958|gb|EEF40555.1| hypothetical protein RCOM_1329260 [Ricinus communis] Length = 293 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 YLQSLHYQIEKLKGISHMIKCACGEEYKVDVGLRA 106 YLQSL QI+KLKGISHMIKCACG EYKV++ L A Sbjct: 259 YLQSLQDQIDKLKGISHMIKCACGMEYKVEMDLCA 293