BLASTX nr result
ID: Paeonia23_contig00039726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039726 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032594.1| Pentatricopeptide repeat (PPR) superfamily p... 142 5e-32 emb|CBI22243.3| unnamed protein product [Vitis vinifera] 141 1e-31 ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containi... 141 1e-31 ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containi... 134 1e-29 ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containi... 134 1e-29 ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_007215675.1| hypothetical protein PRUPE_ppa003946mg [Prun... 133 2e-29 ref|XP_002324070.1| pentatricopeptide repeat-containing family p... 132 5e-29 ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] 130 2e-28 ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containi... 129 4e-28 ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citr... 129 5e-28 ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 ref|XP_007139531.1| hypothetical protein PHAVU_008G037800g [Phas... 125 6e-27 gb|EYU34053.1| hypothetical protein MIMGU_mgv1a004068mg [Mimulus... 124 1e-26 ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutr... 124 2e-26 ref|XP_003621264.1| Pentatricopeptide repeat-containing protein ... 124 2e-26 ref|NP_197034.2| pentatricopeptide repeat-containing protein [Ar... 123 2e-26 ref|XP_002873718.1| pentatricopeptide repeat-containing protein ... 123 2e-26 >ref|XP_007032594.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508711623|gb|EOY03520.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 549 Score = 142 bits (358), Expect = 5e-32 Identities = 64/83 (77%), Positives = 75/83 (90%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + +M I+PN I+WRTLLGAC IHGNVEL ++ANE+LLK+RR+QSGDYVLLSNIYAS+GEW Sbjct: 439 IDSMEIEPNAIIWRTLLGACRIHGNVELGRRANERLLKMRREQSGDYVLLSNIYASKGEW 498 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG EKVRK+MDDSG KEPGCSL Sbjct: 499 DGVEKVRKMMDDSGVTKEPGCSL 521 >emb|CBI22243.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 141 bits (355), Expect = 1e-31 Identities = 65/83 (78%), Positives = 74/83 (89%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + TM+I+PN IVWRTLLGAC IHGNVEL ++AN QLLK+R D+SGDYVLLSNIYAS+GEW Sbjct: 402 IDTMKIEPNAIVWRTLLGACRIHGNVELGRRANMQLLKMRHDESGDYVLLSNIYASRGEW 461 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG EKVRKLMDDSG +KE GCSL Sbjct: 462 DGVEKVRKLMDDSGVRKEAGCSL 484 >ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vitis vinifera] Length = 550 Score = 141 bits (355), Expect = 1e-31 Identities = 65/83 (78%), Positives = 74/83 (89%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + TM+I+PN IVWRTLLGAC IHGNVEL ++AN QLLK+R D+SGDYVLLSNIYAS+GEW Sbjct: 437 IDTMKIEPNAIVWRTLLGACRIHGNVELGRRANMQLLKMRHDESGDYVLLSNIYASRGEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG EKVRKLMDDSG +KE GCSL Sbjct: 497 DGVEKVRKLMDDSGVRKEAGCSL 519 >ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like, partial [Cucumis sativus] Length = 315 Score = 134 bits (338), Expect = 1e-29 Identities = 61/83 (73%), Positives = 73/83 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + TM I+PN I+WRTLLGAC +HG+VEL ++ANEQLLK+R+D+SGDYVLLSNIYASQGEW Sbjct: 210 IDTMEIEPNAIIWRTLLGACRVHGDVELGRRANEQLLKMRKDESGDYVLLSNIYASQGEW 269 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG +KVRKLMDD G KK+ G SL Sbjct: 270 DGVQKVRKLMDDGGVKKKVGHSL 292 >ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 542 Score = 134 bits (338), Expect = 1e-29 Identities = 61/83 (73%), Positives = 73/83 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + TM I+PN I+WRTLLGAC +HG+VEL ++ANEQLLK+R+D+SGDYVLLSNIYASQGEW Sbjct: 437 IDTMEIEPNAIIWRTLLGACRVHGDVELGRRANEQLLKMRKDESGDYVLLSNIYASQGEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG +KVRKLMDD G KK+ G SL Sbjct: 497 DGVQKVRKLMDDGGVKKKVGHSL 519 >ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum tuberosum] Length = 539 Score = 134 bits (336), Expect = 2e-29 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 ++TM IKPN I+WRTLLGAC +H NVEL + ANEQLLK+ R+ SGDYVLLSNIYAS+ EW Sbjct: 437 INTMEIKPNAIIWRTLLGACKVHSNVELGRYANEQLLKLGREDSGDYVLLSNIYASRDEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG E+VRKLMDD+G KEPGC+L Sbjct: 497 DGVERVRKLMDDNGVWKEPGCTL 519 >ref|XP_007215675.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica] gi|462411825|gb|EMJ16874.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica] Length = 539 Score = 133 bits (335), Expect = 2e-29 Identities = 61/83 (73%), Positives = 73/83 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + M I+PN IVWRTLLGAC +HGNVEL ++ANE+LL++RRD+SGD+VLLSNIYAS+GEW Sbjct: 437 IEKMEIEPNAIVWRTLLGACRVHGNVELGRRANERLLEMRRDESGDFVLLSNIYASRGEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 G E+VRKLMDDSG KKEPG SL Sbjct: 497 RGVEEVRKLMDDSGVKKEPGYSL 519 >ref|XP_002324070.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867072|gb|EEF04203.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 546 Score = 132 bits (332), Expect = 5e-29 Identities = 61/80 (76%), Positives = 70/80 (87%) Frame = -3 Query: 242 MRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEWDGA 63 M I+PN I+WRTLLGAC +HGNVEL + ANE+LLK+RRD+SGDYVLLSNIYAS GEWDGA Sbjct: 441 MEIEPNAIIWRTLLGACRVHGNVELGRLANERLLKLRRDESGDYVLLSNIYASAGEWDGA 500 Query: 62 EKVRKLMDDSGAKKEPGCSL 3 E+VRKLMDD G +KE G SL Sbjct: 501 EEVRKLMDDGGVRKEAGRSL 520 >ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] Length = 518 Score = 130 bits (328), Expect = 1e-28 Identities = 60/82 (73%), Positives = 72/82 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + +M+I+PN IVWR+LLGAC +HG+VELAK+ANEQLL++R DQSGDYVLLSN+YASQGEW Sbjct: 431 IASMKIEPNAIVWRSLLGACKVHGDVELAKRANEQLLRMRGDQSGDYVLLSNVYASQGEW 490 Query: 71 DGAEKVRKLMDDSGAKKEPGCS 6 DGAE VRKLMDD+G K G S Sbjct: 491 DGAENVRKLMDDNGVTKNRGSS 512 >gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] Length = 512 Score = 130 bits (327), Expect = 2e-28 Identities = 61/83 (73%), Positives = 73/83 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + TM I+ NGIVWRTLLGAC IHGNVELAK+A+++LL++R ++SGDYVLLSNIYASQGEW Sbjct: 402 METMEIESNGIVWRTLLGACRIHGNVELAKRASDELLRMRTNESGDYVLLSNIYASQGEW 461 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 +GAEKVR+ MD SG KE GCSL Sbjct: 462 NGAEKVRESMDKSGVMKEAGCSL 484 >ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum lycopersicum] Length = 539 Score = 130 bits (326), Expect = 2e-28 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 ++TM IKPN I+WRTLLGAC +H NV+L + AN+QLLK+ R+ SGDYVLLSNIYAS+ EW Sbjct: 437 INTMDIKPNAIIWRTLLGACKVHSNVKLGRYANKQLLKLGREDSGDYVLLSNIYASRDEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG E+VRKLMDD+G KEPGC+L Sbjct: 497 DGVERVRKLMDDNGVWKEPGCTL 519 >ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 540 Score = 129 bits (324), Expect = 4e-28 Identities = 59/83 (71%), Positives = 72/83 (86%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + M ++PN IVWRTLLGAC +HGNVEL ++ANE+LL+IR D+SGD+VLLSNIYAS+GEW Sbjct: 437 IENMEMQPNAIVWRTLLGACKVHGNVELGRRANERLLEIRGDESGDFVLLSNIYASRGEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 GAE+VRKLMDDSG KKE G S+ Sbjct: 497 HGAEEVRKLMDDSGVKKEAGFSM 519 >ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] gi|557533257|gb|ESR44440.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] Length = 540 Score = 129 bits (323), Expect = 5e-28 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + M I+PN I+WRTLLGAC +HG+VEL + AN++LL +R+D+SGDYVLLSNIYASQGEW Sbjct: 432 IDNMDIEPNAIIWRTLLGACRVHGDVELGRLANKRLLNMRKDESGDYVLLSNIYASQGEW 491 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 + EKVRKLMDDS KK+PGCSL Sbjct: 492 NRVEKVRKLMDDSDIKKQPGCSL 514 >ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Citrus sinensis] Length = 540 Score = 125 bits (314), Expect = 6e-27 Identities = 57/83 (68%), Positives = 70/83 (84%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + M I+ N I+WRTLLGAC +HG+VEL + AN++LL +R+D+SGDYVLLSNIYASQGEW Sbjct: 432 IDNMDIEANAIIWRTLLGACRVHGDVELGRLANKRLLNMRKDESGDYVLLSNIYASQGEW 491 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 + EKVRKLMDDS KK+PGCSL Sbjct: 492 NRVEKVRKLMDDSEIKKQPGCSL 514 >ref|XP_007139531.1| hypothetical protein PHAVU_008G037800g [Phaseolus vulgaris] gi|561012664|gb|ESW11525.1| hypothetical protein PHAVU_008G037800g [Phaseolus vulgaris] Length = 518 Score = 125 bits (314), Expect = 6e-27 Identities = 55/82 (67%), Positives = 72/82 (87%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + +M+++PN IVWR+LLGAC +HG+V++AKQ NEQLL++R +QSGDYVLLSN+YASQGEW Sbjct: 431 IASMKLEPNAIVWRSLLGACKVHGDVDMAKQINEQLLRMRGNQSGDYVLLSNVYASQGEW 490 Query: 71 DGAEKVRKLMDDSGAKKEPGCS 6 +GAEK+RKLMDD+G K G S Sbjct: 491 NGAEKIRKLMDDNGVTKNRGSS 512 >gb|EYU34053.1| hypothetical protein MIMGU_mgv1a004068mg [Mimulus guttatus] Length = 545 Score = 124 bits (311), Expect = 1e-26 Identities = 58/83 (69%), Positives = 67/83 (80%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + M +PN I+WRTLLGAC IH NVEL + ANE+LLK+RRD+SGDYVLLSNIYAS GEW Sbjct: 437 IDMMEFEPNAIIWRTLLGACRIHCNVELGRLANEKLLKLRRDESGDYVLLSNIYASNGEW 496 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 G E VRKLMD++G KKE G SL Sbjct: 497 SGVENVRKLMDETGVKKERGFSL 519 >ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] gi|557101140|gb|ESQ41503.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] Length = 547 Score = 124 bits (310), Expect = 2e-26 Identities = 58/83 (69%), Positives = 68/83 (81%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 V +M I+PN IVWRTLLGAC I+GNVEL K ANE+LL +R+D+SGDYVLLSNIYAS GEW Sbjct: 439 VESMEIEPNAIVWRTLLGACRIYGNVELGKYANEKLLSLRKDESGDYVLLSNIYASTGEW 498 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 D +KVRK+ DD+G KK G SL Sbjct: 499 DRVQKVRKMFDDTGVKKPTGYSL 521 >ref|XP_003621264.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496279|gb|AES77482.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 519 Score = 124 bits (310), Expect = 2e-26 Identities = 56/82 (68%), Positives = 69/82 (84%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 + +M+I+PN I+WRTLL AC +HG+VELAK ANE+L +R+D SGDYVL+SN+YAS+GEW Sbjct: 432 IDSMKIEPNAIIWRTLLAACKVHGDVELAKVANEKLFSMRKDHSGDYVLMSNLYASRGEW 491 Query: 71 DGAEKVRKLMDDSGAKKEPGCS 6 DGAEKVRKLMDDSG K G S Sbjct: 492 DGAEKVRKLMDDSGVTKIRGSS 513 >ref|NP_197034.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635759|sp|Q9LXF2.2|PP385_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15300 gi|332004762|gb|AED92145.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 548 Score = 123 bits (309), Expect = 2e-26 Identities = 57/83 (68%), Positives = 69/83 (83%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 V +M+I+PN IVWRTLLGAC I+GNVEL K ANE+LL +R+D+SGDYVLLSNIYAS G+W Sbjct: 439 VESMKIEPNAIVWRTLLGACKIYGNVELGKYANEKLLSMRKDESGDYVLLSNIYASTGQW 498 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG +KVRK+ DD+ KK G SL Sbjct: 499 DGVQKVRKMFDDTRVKKPTGVSL 521 >ref|XP_002873718.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319555|gb|EFH49977.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 548 Score = 123 bits (309), Expect = 2e-26 Identities = 57/83 (68%), Positives = 69/83 (83%) Frame = -3 Query: 251 VHTMRIKPNGIVWRTLLGACTIHGNVELAKQANEQLLKIRRDQSGDYVLLSNIYASQGEW 72 V +M+I+PN IVWRTLLGAC I+GNVEL K ANE+LL +R+D+SGDYVLLSNIYAS G+W Sbjct: 439 VESMKIEPNAIVWRTLLGACKIYGNVELGKYANEKLLSMRKDESGDYVLLSNIYASTGQW 498 Query: 71 DGAEKVRKLMDDSGAKKEPGCSL 3 DG +KVRK+ DD+ KK G SL Sbjct: 499 DGVQKVRKMFDDTRVKKPTGISL 521