BLASTX nr result
ID: Paeonia23_contig00039706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039706 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521161.1| photosystem I reaction center subunit IV A, ... 56 5e-06 >ref|XP_002521161.1| photosystem I reaction center subunit IV A, chloroplast precursor [Ricinus communis] gi|223539730|gb|EEF41312.1| photosystem I reaction center subunit IV A, chloroplast precursor [Ricinus communis] Length = 141 Score = 56.2 bits (134), Expect = 5e-06 Identities = 42/85 (49%), Positives = 48/85 (56%), Gaps = 11/85 (12%) Frame = -2 Query: 371 ALCSMASAARGFVVTPNITSNT--ASRSNML-FSSKN---NNSRLVVR-----XXXXXXX 225 A CSMASAA GF++TPN+ +NT +SRSNM+ F SKN NNSRLVVR Sbjct: 2 ASCSMASAASGFLLTPNVPANTNSSSRSNMVYFPSKNNNINNSRLVVRAAEEAAAPAPAT 61 Query: 224 XXXXXXXXXXXXXXXPIGPKRGTKV 150 PIGPKRGTKV Sbjct: 62 TTAPAEGEAPKPKPPPIGPKRGTKV 86