BLASTX nr result
ID: Paeonia23_contig00039697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039697 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38411.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_007046540.1| Squamosa promoter-binding protein-like 12 [T... 80 3e-13 ref|XP_002509450.1| Squamosa promoter-binding protein, putative ... 79 9e-13 ref|XP_006600599.1| PREDICTED: squamosa promoter-binding-like pr... 78 1e-12 ref|NP_191351.1| squamosa promoter-binding-like protein 15 [Arab... 77 2e-12 ref|XP_002878178.1| hypothetical protein ARALYDRAFT_486243 [Arab... 77 2e-12 ref|XP_007155210.1| hypothetical protein PHAVU_003G182900g [Phas... 77 2e-12 ref|XP_006291402.1| hypothetical protein CARUB_v10017540mg [Caps... 77 3e-12 gb|ADL36827.1| SPL domain class transcription factor [Malus dome... 77 3e-12 ref|XP_006402825.1| hypothetical protein EUTSA_v10006058mg [Eutr... 76 4e-12 ref|XP_002879473.1| hypothetical protein ARALYDRAFT_482334 [Arab... 76 4e-12 ref|XP_006579490.1| PREDICTED: squamosa promoter-binding-like pr... 76 6e-12 ref|XP_004304380.1| PREDICTED: squamosa promoter-binding-like pr... 75 9e-12 ref|XP_007205341.1| hypothetical protein PRUPE_ppa007056mg [Prun... 75 9e-12 ref|XP_007203426.1| hypothetical protein PRUPE_ppa021582mg [Prun... 75 9e-12 gb|AEW23126.1| SQUAMOSA promoter binding protein-like protein [F... 75 9e-12 ref|XP_006410530.1| hypothetical protein EUTSA_v10017406mg [Eutr... 75 1e-11 gb|EPS74236.1| hypothetical protein M569_00519, partial [Genlise... 75 1e-11 gb|AGP03027.1| SQUAMOSA promoter binding protein-like protein 3 ... 75 1e-11 ref|XP_006295226.1| hypothetical protein CARUB_v10024311mg [Caps... 75 1e-11 >emb|CBI38411.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 87.0 bits (214), Expect = 2e-15 Identities = 53/121 (43%), Positives = 66/121 (54%), Gaps = 1/121 (0%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 GI +RFCQQCSRFHE+S+FD KRSCRKRLA HN+RRRK QP P + ++PP N Sbjct: 120 GIEQRFCQQCSRFHEISQFDDTKRSCRKRLAGHNQRRRKNQPDPPHTEDRRKPP-----N 174 Query: 182 SGGPENGEVVGSCIKPECLQVEVEQKEVPFKMNGNSLKATALPDYSEIDGR-RTFIKHLR 358 S KMN +SLKAT D +E+ R ++ I+H R Sbjct: 175 S-----------------------------KMNASSLKATEHSDDNELSFRGQSNIRHFR 205 Query: 359 I 361 I Sbjct: 206 I 206 >ref|XP_007046540.1| Squamosa promoter-binding protein-like 12 [Theobroma cacao] gi|508698801|gb|EOX90697.1| Squamosa promoter-binding protein-like 12 [Theobroma cacao] Length = 198 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/88 (47%), Positives = 55/88 (62%), Gaps = 7/88 (7%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 GI +RFCQQCSRFHE+SEFD KRSCR RLA HNERRRKVQ E + P +M + Sbjct: 110 GIRQRFCQQCSRFHEISEFDSTKRSCRDRLAGHNERRRKVQSDQQAEDVERSPASEMNTS 169 Query: 182 ------SGGPENGEV-VGSCIKPECLQV 244 + P++GE+ + C P+ ++ Sbjct: 170 MVKMQAARHPKHGELTLQGCTDPKRFRI 197 >ref|XP_002509450.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223549349|gb|EEF50837.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 141 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRK 118 GIH+RFCQQCSRFHEVSEFD KRSCR+RLA HNERRRK Sbjct: 92 GIHQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRK 130 >ref|XP_006600599.1| PREDICTED: squamosa promoter-binding-like protein 18-like isoform X1 [Glycine max] gi|571534756|ref|XP_006600600.1| PREDICTED: squamosa promoter-binding-like protein 18-like isoform X2 [Glycine max] Length = 544 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/79 (51%), Positives = 48/79 (60%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 GI +RFCQQCSRFH ++EFD KRSCRKRLA HNERRRK Q G+ GK C Sbjct: 202 GIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQMGIH---PGKSGTLLQPCG 258 Query: 182 SGGPENGEVVGSCIKPECL 238 + + S I+PE L Sbjct: 259 DSRFQGSMLTSSFIRPEML 277 >ref|NP_191351.1| squamosa promoter-binding-like protein 15 [Arabidopsis thaliana] gi|67461582|sp|Q9M2Q6.1|SPL15_ARATH RecName: Full=Squamosa promoter-binding-like protein 15 gi|6729535|emb|CAB67620.1| squamosa promoter-binding protein homolog [Arabidopsis thaliana] gi|21592501|gb|AAM64451.1| squamosa promoter-binding protein homolog [Arabidopsis thaliana] gi|332646196|gb|AEE79717.1| squamosa promoter-binding-like protein 15 [Arabidopsis thaliana] Length = 354 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQP 127 G+H+RFCQQCSRFH++SEFD KRSCR+RLA HNERRRK QP Sbjct: 94 GLHQRFCQQCSRFHQLSEFDLEKRSCRRRLACHNERRRKPQP 135 >ref|XP_002878178.1| hypothetical protein ARALYDRAFT_486243 [Arabidopsis lyrata subsp. lyrata] gi|297324016|gb|EFH54437.1| hypothetical protein ARALYDRAFT_486243 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQP 127 G+H+RFCQQCSRFH++SEFD KRSCR+RLA HNERRRK QP Sbjct: 94 GLHQRFCQQCSRFHQLSEFDLEKRSCRRRLACHNERRRKPQP 135 >ref|XP_007155210.1| hypothetical protein PHAVU_003G182900g [Phaseolus vulgaris] gi|561028564|gb|ESW27204.1| hypothetical protein PHAVU_003G182900g [Phaseolus vulgaris] Length = 549 Score = 77.0 bits (188), Expect = 2e-12 Identities = 41/79 (51%), Positives = 48/79 (60%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 GI +RFCQQCSRFH ++EFD KRSCRKRLA HNERRRK Q G+ GK C Sbjct: 207 GIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQMGIH---PGKSGRLLQPCG 263 Query: 182 SGGPENGEVVGSCIKPECL 238 + + S I+PE L Sbjct: 264 DSRFQGTMLTSSFIRPEML 282 >ref|XP_006291402.1| hypothetical protein CARUB_v10017540mg [Capsella rubella] gi|482560109|gb|EOA24300.1| hypothetical protein CARUB_v10017540mg [Capsella rubella] Length = 352 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQP 127 G+H+RFCQQCSRFH +SEFD KRSCR+RLA HNERRRK QP Sbjct: 96 GLHQRFCQQCSRFHHLSEFDLEKRSCRRRLACHNERRRKPQP 137 >gb|ADL36827.1| SPL domain class transcription factor [Malus domestica] Length = 188 Score = 76.6 bits (187), Expect = 3e-12 Identities = 44/97 (45%), Positives = 55/97 (56%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 G+H+RFCQQCSRFH++ EFD KRSCR+ LA HNERRRK P VEG CN Sbjct: 100 GLHQRFCQQCSRFHQLPEFDDTKRSCRRHLAGHNERRRK-NPAESHAVEGSS------CN 152 Query: 182 SGGPENGEVVGSCIKPECLQVEVEQKEVPFKMNGNSL 292 G G+ K C QV+ + + + GNS+ Sbjct: 153 VG-------AGTQFKDVCGQVD-DSGRIRITIPGNSI 181 >ref|XP_006402825.1| hypothetical protein EUTSA_v10006058mg [Eutrema salsugineum] gi|557103924|gb|ESQ44278.1| hypothetical protein EUTSA_v10006058mg [Eutrema salsugineum] Length = 358 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQ 124 G+H+RFCQQCSRFH++SEFD KRSCR+RLA HNERRRK Q Sbjct: 99 GLHQRFCQQCSRFHQLSEFDSEKRSCRRRLACHNERRRKPQ 139 >ref|XP_002879473.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. lyrata] gi|297325312|gb|EFH55732.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. lyrata] Length = 130 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRK 118 G+H+RFCQQCSRFHE+SEFD KRSCR+RLA HNERRRK Sbjct: 88 GLHQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRK 126 >ref|XP_006579490.1| PREDICTED: squamosa promoter-binding-like protein 6-like [Glycine max] Length = 549 Score = 75.9 bits (185), Expect = 6e-12 Identities = 41/79 (51%), Positives = 47/79 (59%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPGLPVEVEGKEPPYKMICN 181 GI +RFCQQCSRFH ++EFD KRSCRKRLA HNERRRK Q G+ GK C Sbjct: 207 GIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQMGIH---PGKSGRLLQPCG 263 Query: 182 SGGPENGEVVGSCIKPECL 238 + + S I PE L Sbjct: 264 DSRFQGSMLTSSFICPEML 282 >ref|XP_004304380.1| PREDICTED: squamosa promoter-binding-like protein 17-like [Fragaria vesca subsp. vesca] Length = 380 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPG 130 G+ +RFCQQCSRFH++ EFD KRSCR+RLA HNERRRK QPG Sbjct: 114 GLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQPG 156 >ref|XP_007205341.1| hypothetical protein PRUPE_ppa007056mg [Prunus persica] gi|462400983|gb|EMJ06540.1| hypothetical protein PRUPE_ppa007056mg [Prunus persica] Length = 384 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPG 130 G+ +RFCQQCSRFH++ EFD KRSCR+RLA HNERRRK QPG Sbjct: 117 GLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQPG 159 >ref|XP_007203426.1| hypothetical protein PRUPE_ppa021582mg [Prunus persica] gi|462398957|gb|EMJ04625.1| hypothetical protein PRUPE_ppa021582mg [Prunus persica] Length = 383 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPG 130 G+ +RFCQQCSRFH++ EFD KRSCR+RLA HNERRRK QPG Sbjct: 115 GLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQPG 157 >gb|AEW23126.1| SQUAMOSA promoter binding protein-like protein [Fragaria x ananassa] Length = 380 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPG 130 G+ +RFCQQCSRFH++ EFD KRSCR+RLA HNERRRK QPG Sbjct: 114 GLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQPG 156 >ref|XP_006410530.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum] gi|557111699|gb|ESQ51983.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum] Length = 135 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRK 118 G+H+RFCQQCSRFHE+ EFD KRSCR+RLA HNERRRK Sbjct: 93 GLHQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRK 131 >gb|EPS74236.1| hypothetical protein M569_00519, partial [Genlisea aurea] Length = 109 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRKVQPG 130 G+ RFCQQCSRFH+++EFD KRSCR++LAAHN+RRRK+ PG Sbjct: 56 GVEMRFCQQCSRFHQLAEFDKEKRSCRRKLAAHNQRRRKIPPG 98 >gb|AGP03027.1| SQUAMOSA promoter binding protein-like protein 3 [Arabis alpina] Length = 131 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRK 118 G+H+RFCQQCSRFHE+ EFD KRSCR+RLA HNERRRK Sbjct: 88 GLHQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRK 126 >ref|XP_006295226.1| hypothetical protein CARUB_v10024311mg [Capsella rubella] gi|482563934|gb|EOA28124.1| hypothetical protein CARUB_v10024311mg [Capsella rubella] Length = 130 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 GIHKRFCQQCSRFHEVSEFDGVKRSCRKRLAAHNERRRK 118 G+H+RFCQQCSRFHE+ EFD KRSCR+RLA HNERRRK Sbjct: 88 GLHQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRK 126