BLASTX nr result
ID: Paeonia23_contig00039687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039687 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632721.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 76 6e-12 ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 76 6e-12 ref|XP_007029026.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cac... 70 4e-10 ref|XP_007029025.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cac... 70 4e-10 ref|XP_002534371.1| electron transporter, putative [Ricinus comm... 60 2e-07 ref|XP_004303341.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 58 1e-06 ref|XP_006362211.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 57 2e-06 >ref|XP_003632721.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform 2 [Vitis vinifera] Length = 179 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/70 (51%), Positives = 48/70 (68%) Frame = +2 Query: 131 MSVLAANSHILYRDVLQKDXXXXXXLFNASSCLLLSKSNGFGIDYRKEGWKKIAKRDLKM 310 MS+LAAN+HI+YR+VL +D L SCL S+S GFG+D R+ W+K KRD ++ Sbjct: 1 MSILAANTHIVYREVLLRDPQNQ--LSGGGSCLFWSRSPGFGVDGRRGEWRKTKKRDFRV 58 Query: 311 EAFWSDVQRP 340 EAFW D+ RP Sbjct: 59 EAFWPDMTRP 68 >ref|XP_002275794.1| PREDICTED: thioredoxin-like 3-1, chloroplastic isoform 1 [Vitis vinifera] Length = 185 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/70 (51%), Positives = 48/70 (68%) Frame = +2 Query: 131 MSVLAANSHILYRDVLQKDXXXXXXLFNASSCLLLSKSNGFGIDYRKEGWKKIAKRDLKM 310 MS+LAAN+HI+YR+VL +D L SCL S+S GFG+D R+ W+K KRD ++ Sbjct: 1 MSILAANTHIVYREVLLRDPQNQ--LSGGGSCLFWSRSPGFGVDGRRGEWRKTKKRDFRV 58 Query: 311 EAFWSDVQRP 340 EAFW D+ RP Sbjct: 59 EAFWPDMTRP 68 >ref|XP_007029026.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cacao] gi|508717631|gb|EOY09528.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cacao] Length = 139 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = +2 Query: 131 MSVLAANSHILYRDVLQKDXXXXXXLFNASSCLLLSKSNG-FGIDYRKEGWKK-IAKRDL 304 MSVLAANS ILYR+ Q+D L+N+ SC+LL K+ G FG D R WKK IA+RD Sbjct: 1 MSVLAANSQILYREFYQRD--QQQQLWNSGSCMLLQKNCGYFGFDRRNGKWKKNIARRDW 58 Query: 305 KMEAFWSDVQRP 340 ++EA W D+ RP Sbjct: 59 RVEALWPDLSRP 70 >ref|XP_007029025.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cacao] gi|508717630|gb|EOY09527.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cacao] Length = 187 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = +2 Query: 131 MSVLAANSHILYRDVLQKDXXXXXXLFNASSCLLLSKSNG-FGIDYRKEGWKK-IAKRDL 304 MSVLAANS ILYR+ Q+D L+N+ SC+LL K+ G FG D R WKK IA+RD Sbjct: 1 MSVLAANSQILYREFYQRD--QQQQLWNSGSCMLLQKNCGYFGFDRRNGKWKKNIARRDW 58 Query: 305 KMEAFWSDVQRP 340 ++EA W D+ RP Sbjct: 59 RVEALWPDLSRP 70 >ref|XP_002534371.1| electron transporter, putative [Ricinus communis] gi|223525411|gb|EEF28009.1| electron transporter, putative [Ricinus communis] Length = 190 Score = 60.5 bits (145), Expect = 2e-07 Identities = 38/77 (49%), Positives = 50/77 (64%), Gaps = 7/77 (9%) Frame = +2 Query: 131 MSVLAANSHILYRDVL-QKDXXXXXXLFNAS-SCLLLSKSNGFG----IDYRK-EGWKKI 289 MS LAANSHILYR+V Q+D L+++S SC LL + G D +K +KKI Sbjct: 1 MSSLAANSHILYREVYNQRDQQQQHQLWSSSGSCCLLLQQRNSGCYNLFDCKKTRSFKKI 60 Query: 290 AKRDLKMEAFWSDVQRP 340 +KRDL++EAFW D+ RP Sbjct: 61 SKRDLRVEAFWPDMTRP 77 >ref|XP_004303341.1| PREDICTED: thioredoxin-like 3-1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 197 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/66 (50%), Positives = 39/66 (59%) Frame = +2 Query: 131 MSVLAANSHILYRDVLQKDXXXXXXLFNASSCLLLSKSNGFGIDYRKEGWKKIAKRDLKM 310 MSVLAANSHI R+V Q++ A L KS+GFG YR KKI +RDLK Sbjct: 1 MSVLAANSHIFCREVHQREHQQQFCSA-AGGSFALPKSSGFGFFYRNRDSKKILRRDLKA 59 Query: 311 EAFWSD 328 EAFW + Sbjct: 60 EAFWPE 65 >ref|XP_006362211.1| PREDICTED: thioredoxin-like 3-1, chloroplastic-like [Solanum tuberosum] Length = 214 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 1/99 (1%) Frame = +2 Query: 47 TPTFKLLSITEYDFLQPIRLKIHHQ*VRMSVLAANSHILYRDVLQKDXXXXXXLFNASSC 226 TP + +L T F P K +MS+LA NS ILYR++ ++ + N+ Sbjct: 7 TPKYLILFYTVTSFQVPKTSK------KMSILAPNSQILYREIYNRENQHL--VLNSGGN 58 Query: 227 LLLSKSNGFG-IDYRKEGWKKIAKRDLKMEAFWSDVQRP 340 L + KS GF +D R+ WKK KR++++ A W+D+ RP Sbjct: 59 LNIVKSYGFCFVDKRRGDWKKKIKREIRIHASWADLSRP 97