BLASTX nr result
ID: Paeonia23_contig00039099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00039099 (517 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298374.1| hypothetical protein POPTR_0001s24230g [Popu... 55 1e-05 >ref|XP_002298374.1| hypothetical protein POPTR_0001s24230g [Populus trichocarpa] gi|222845632|gb|EEE83179.1| hypothetical protein POPTR_0001s24230g [Populus trichocarpa] Length = 335 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = -2 Query: 153 MMKLTSSNYWIWKSRMKDFLICNDLCEPIYGDESKPSDMPPQDWEIMRRE 4 M+KLTSSNY++WK+ M+D L CNDL PI KP DM W + R+ Sbjct: 8 MIKLTSSNYFLWKTMMEDHLYCNDLALPIECKGIKPDDMDDAKWNGLNRK 57