BLASTX nr result
ID: Paeonia23_contig00038816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00038816 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_007213606.1| hypothetical protein PRUPE_ppa002332mg [Prun... 72 6e-11 gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Mimulus... 71 1e-10 ref|XP_002512769.1| pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citr... 69 7e-10 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 69 7e-10 ref|XP_007160443.1| hypothetical protein PHAVU_002G3226001g [Pha... 69 9e-10 ref|XP_006451427.1| hypothetical protein CICLE_v10008172mg [Citr... 69 9e-10 ref|XP_007012889.1| Tetratricopeptide repeat-like superfamily pr... 69 9e-10 ref|XP_007217844.1| hypothetical protein PRUPE_ppa024283mg [Prun... 68 1e-09 ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 emb|CBI21289.3| unnamed protein product [Vitis vinifera] 68 1e-09 gb|EXC17350.1| hypothetical protein L484_027540 [Morus notabilis] 67 2e-09 gb|EXB38821.1| Serine acetyltransferase 5 [Morus notabilis] 67 2e-09 ref|XP_007152924.1| hypothetical protein PHAVU_004G171700g [Phas... 67 2e-09 ref|XP_004294814.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_007202366.1| hypothetical protein PRUPE_ppa009223mg [Prun... 67 2e-09 >ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] gi|297736133|emb|CBI24171.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIKFMAKIVGV+IIVRDSLRFHHFRDGLCSC +FW Sbjct: 651 HNAIKFMAKIVGVKIIVRDSLRFHHFRDGLCSCQDFW 687 >ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum tuberosum] Length = 686 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK++AKIVGV+IIVRD LRFHHF+DGLCSC +FW Sbjct: 650 HNAIKYLAKIVGVQIIVRDPLRFHHFKDGLCSCRDFW 686 >ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 685 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK++AKIVGV+IIVRD LRFHHF+DGLCSC +FW Sbjct: 649 HNAIKYLAKIVGVQIIVRDPLRFHHFKDGLCSCRDFW 685 >ref|XP_007213606.1| hypothetical protein PRUPE_ppa002332mg [Prunus persica] gi|462409471|gb|EMJ14805.1| hypothetical protein PRUPE_ppa002332mg [Prunus persica] Length = 686 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIKFM KIVGV+IIVRDSLRFHHF+DG CSC +FW Sbjct: 650 HNAIKFMGKIVGVQIIVRDSLRFHHFKDGDCSCRDFW 686 >gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Mimulus guttatus] Length = 687 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 H+ IKF+AK VGV++IVRDSLRFHHF DG+CSCG+FW Sbjct: 651 HSTIKFIAKFVGVQVIVRDSLRFHHFTDGICSCGDFW 687 >ref|XP_002512769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547780|gb|EEF49272.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 684 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK +AKIVG++IIVRDSLRFHHFRDG C+C +FW Sbjct: 648 HNAIKLIAKIVGMQIIVRDSLRFHHFRDGYCTCNDFW 684 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Citrus sinensis] gi|568839239|ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Citrus sinensis] Length = 799 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNA KFM+K+VG EI+VRD RFHHFRDG CSCG++W Sbjct: 763 HNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] gi|557537225|gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNA KFM+K+VG EI+VRD RFHHFRDG CSCG++W Sbjct: 763 HNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNA KFM+K+VG EI+VRD RFHHFRDG CSCG++W Sbjct: 761 HNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >ref|XP_007160443.1| hypothetical protein PHAVU_002G3226001g [Phaseolus vulgaris] gi|561033858|gb|ESW32437.1| hypothetical protein PHAVU_002G3226001g [Phaseolus vulgaris] Length = 683 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 H AIKFMAKIVG EIIVRD+ RFHHFR+G CSCG++W Sbjct: 647 HTAIKFMAKIVGREIIVRDNSRFHHFRNGSCSCGDYW 683 >ref|XP_006451427.1| hypothetical protein CICLE_v10008172mg [Citrus clementina] gi|568842990|ref|XP_006475408.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Citrus sinensis] gi|557554653|gb|ESR64667.1| hypothetical protein CICLE_v10008172mg [Citrus clementina] Length = 475 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHFRDG CSCG++W Sbjct: 439 HNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCGDYW 475 >ref|XP_007012889.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508783252|gb|EOY30508.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 485 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHFRDG CSCG++W Sbjct: 449 HNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCGDYW 485 >ref|XP_007217844.1| hypothetical protein PRUPE_ppa024283mg [Prunus persica] gi|462413994|gb|EMJ19043.1| hypothetical protein PRUPE_ppa024283mg [Prunus persica] Length = 717 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 H AIK M KIVG EI VRDS RFHHFRDGLCSCG+FW Sbjct: 681 HAAIKVMTKIVGREITVRDSSRFHHFRDGLCSCGDFW 717 >ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Length = 735 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 H AIKF++KIV EI+VRDS RFHHFRDGLCSCG++W Sbjct: 699 HTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 735 >emb|CBI21289.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 H AIKF++KIV EI+VRDS RFHHFRDGLCSCG++W Sbjct: 545 HTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 581 >gb|EXC17350.1| hypothetical protein L484_027540 [Morus notabilis] Length = 593 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHF+DG CSCG++W Sbjct: 557 HNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 593 >gb|EXB38821.1| Serine acetyltransferase 5 [Morus notabilis] Length = 819 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHF+DG CSCG++W Sbjct: 783 HNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 819 >ref|XP_007152924.1| hypothetical protein PHAVU_004G171700g [Phaseolus vulgaris] gi|561026233|gb|ESW24918.1| hypothetical protein PHAVU_004G171700g [Phaseolus vulgaris] Length = 460 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHF+DG CSCG++W Sbjct: 424 HNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 460 >ref|XP_004294814.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Fragaria vesca subsp. vesca] Length = 614 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHF+DG CSCG++W Sbjct: 578 HNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 614 >ref|XP_007202366.1| hypothetical protein PRUPE_ppa009223mg [Prunus persica] gi|462397897|gb|EMJ03565.1| hypothetical protein PRUPE_ppa009223mg [Prunus persica] Length = 301 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 HNAIKFMAKIVGVEIIVRDSLRFHHFRDGLCSCGEFW 112 HNAIK M+KIVG E+IVRD+ RFHHF+DG CSCG++W Sbjct: 265 HNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 301