BLASTX nr result
ID: Paeonia23_contig00038786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00038786 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271001.1| PREDICTED: putative phospholipid:diacylglyce... 63 5e-08 >ref|XP_002271001.1| PREDICTED: putative phospholipid:diacylglycerol acyltransferase 2 [Vitis vinifera] Length = 688 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 105 MALILRFRKLCYIEPVNCSSLGLESFPTPKIDKKE 1 MA ILRFRKLCY+EPV CSSLG ESF TPKI+KK+ Sbjct: 1 MASILRFRKLCYVEPVKCSSLGFESFETPKIEKKD 35