BLASTX nr result
ID: Paeonia23_contig00038365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00038365 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248773.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] 69 7e-10 ref|XP_002512558.1| pentatricopeptide repeat-containing protein,... 67 2e-09 ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Popu... 65 7e-09 ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EXC28035.1| hypothetical protein L484_022268 [Morus notabilis] 62 1e-07 ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citr... 60 2e-07 ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_004146407.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_007010601.1| Tetratricopeptide repeat-like superfamily pr... 60 4e-07 ref|XP_006409688.1| hypothetical protein EUTSA_v10022652mg [Eutr... 59 7e-07 ref|XP_006299538.1| hypothetical protein CARUB_v10015710mg [Caps... 59 9e-07 sp|Q0WP85.1|PP150_ARATH RecName: Full=Pentatricopeptide repeat-c... 59 9e-07 ref|XP_007138515.1| hypothetical protein PHAVU_009G215700g [Phas... 57 2e-06 ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prun... 57 3e-06 ref|XP_003598203.1| Pentatricopeptide repeat-containing protein ... 56 6e-06 >ref|XP_004248773.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] Length = 532 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 156 QTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 Q P LP F+PSNDA+L+S++LLQHHNPFH MESSLQL+GI Sbjct: 40 QQTPPELPQFEPSNDADLISQLLLQHHNPFHAMESSLQLHGI 81 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 162 LKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 L LPS QPS DA+L+SKILLQHHNPFH MESSLQLNGI Sbjct: 40 LSTGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGI 79 >emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] Length = 525 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 162 LKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 L LPS QPS DA+L+SKILLQHHNPFH MESSLQLNGI Sbjct: 40 LSTGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGI 79 >ref|XP_002512558.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548519|gb|EEF50010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 511 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 141 VPCFSQTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 V C T SLPS +PSNDAE+VS+ILL HHNPFH MESSLQL+GI Sbjct: 21 VQCLFSTF--SLPSLEPSNDAEIVSEILLNHHNPFHAMESSLQLHGI 65 >ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] gi|550338280|gb|EEE93261.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] Length = 548 Score = 65.5 bits (158), Expect = 7e-09 Identities = 42/84 (50%), Positives = 52/84 (61%) Frame = +3 Query: 30 LYNIPRISTFFSLQLSATRLFTSTFEANEIVLSCTDSVPCFSQTLKPSLPSFQPSNDAEL 209 LY+ P + T S L + R F+S N S D+ + TL LP+ QPSNDA+L Sbjct: 6 LYHQPTLLTS-STSLLSLRFFSSI--QNHNFSSDNDAFSPRNDTL---LPTLQPSNDADL 59 Query: 210 VSKILLQHHNPFHTMESSLQLNGI 281 +S+ILL HHNPFH MESSLQL GI Sbjct: 60 LSQILLHHHNPFHAMESSLQLPGI 83 >ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565402271|ref|XP_006366605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565402273|ref|XP_006366606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 520 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 156 QTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 Q P LP F+PSNDA+L+S+ LLQHHNPFH MESSLQL+GI Sbjct: 29 QPTPPELPQFEPSNDADLISQ-LLQHHNPFHAMESSLQLHGI 69 >gb|EXC28035.1| hypothetical protein L484_022268 [Morus notabilis] Length = 540 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 126 SCTDSVPCFSQTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 S D V S LPS +PSNDA+ +S+IL++HHNPFH MESSLQL+G+ Sbjct: 42 SQNDVVSSVSPNHNHHLPSLEPSNDADSISEILVRHHNPFHAMESSLQLHGL 93 >ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|567879147|ref|XP_006432132.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|568821248|ref|XP_006465094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Citrus sinensis] gi|568821250|ref|XP_006465095.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Citrus sinensis] gi|557534253|gb|ESR45371.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|557534254|gb|ESR45372.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] Length = 540 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 174 LPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 LP +PSNDA+L+S+I+L HHNPFH MESSLQL+GI Sbjct: 48 LPKLEPSNDADLLSQIVLAHHNPFHAMESSLQLHGI 83 >ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 501 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 9/55 (16%) Frame = +3 Query: 144 PCFSQTLKPSLPSFQ---------PSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 P FS +L P L S + P NDAELVS ILL HHNPFH MESSLQL+GI Sbjct: 5 PFFSSSLLPLLRSARRRFSSLSSNPQNDAELVSNILLHHHNPFHAMESSLQLHGI 59 >ref|XP_004146407.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cucumis sativus] gi|449523938|ref|XP_004168980.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cucumis sativus] Length = 506 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 162 LKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 L LP QPS DA+LVS+ILL HHNPFH+MESSLQL+ I Sbjct: 25 LSSLLPQIQPSKDADLVSQILLHHHNPFHSMESSLQLHSI 64 >ref|XP_007010601.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508727514|gb|EOY19411.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 612 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/78 (38%), Positives = 46/78 (58%) Frame = +3 Query: 48 ISTFFSLQLSATRLFTSTFEANEIVLSCTDSVPCFSQTLKPSLPSFQPSNDAELVSKILL 227 + + + +L TR + + LS CF + +LP QPS +A+ +S++LL Sbjct: 80 VGSKMAFRLCGTRTLPTAISLRFLPLSSL----CFLSSPSLNLPKLQPSEEADSLSQLLL 135 Query: 228 QHHNPFHTMESSLQLNGI 281 HHNPFH+MESS+QL+GI Sbjct: 136 AHHNPFHSMESSIQLHGI 153 >ref|XP_006409688.1| hypothetical protein EUTSA_v10022652mg [Eutrema salsugineum] gi|557110850|gb|ESQ51141.1| hypothetical protein EUTSA_v10022652mg [Eutrema salsugineum] Length = 513 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +3 Query: 171 SLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 +LP +PSNDAEL+S+IL+ +HNPFH MESSLQL GI Sbjct: 29 NLPKLEPSNDAELISQILVTNHNPFHFMESSLQLQGI 65 >ref|XP_006299538.1| hypothetical protein CARUB_v10015710mg [Capsella rubella] gi|482568247|gb|EOA32436.1| hypothetical protein CARUB_v10015710mg [Capsella rubella] Length = 506 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 153 SQTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 S T +LP +PS DAEL+S++L+ +HNPFH MESSLQLNGI Sbjct: 21 SSTSTLNLPKLEPSPDAELISQMLITNHNPFHFMESSLQLNGI 63 >sp|Q0WP85.1|PP150_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13420, mitochondrial; Flags: Precursor gi|110738270|dbj|BAF01064.1| hypothetical protein [Arabidopsis thaliana] Length = 509 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +3 Query: 171 SLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 +LP +PS+DAEL+S++L+ +HNPFH MESSLQLNGI Sbjct: 31 NLPKLEPSSDAELISQMLITNHNPFHFMESSLQLNGI 67 >ref|XP_007138515.1| hypothetical protein PHAVU_009G215700g [Phaseolus vulgaris] gi|561011602|gb|ESW10509.1| hypothetical protein PHAVU_009G215700g [Phaseolus vulgaris] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +3 Query: 144 PCFSQTLKPSLPSFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 P F + P SNDAELVS +LLQHHNPFH ESSLQL+GI Sbjct: 20 PPFLHRFCSAPPPLSESNDAELVSNLLLQHHNPFHAAESSLQLHGI 65 >ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] gi|462394267|gb|EMJ00171.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] Length = 480 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 192 SNDAELVSKILLQHHNPFHTMESSLQLNGI 281 SNDAEL+SKIL+ HHNPFH+MESSLQL+GI Sbjct: 5 SNDAELISKILVHHHNPFHSMESSLQLHGI 34 >ref|XP_003598203.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355487251|gb|AES68454.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 503 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 180 SFQPSNDAELVSKILLQHHNPFHTMESSLQLNGI 281 S Q NDAEL+SKILL HHNP+H ESSLQLNGI Sbjct: 24 SSQTQNDAELISKILLTHHNPYHFTESSLQLNGI 57