BLASTX nr result
ID: Paeonia23_contig00038212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00038212 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239552.1| PREDICTED: uncharacterized protein LOC101245... 40 4e-07 >ref|XP_004239552.1| PREDICTED: uncharacterized protein LOC101245459 [Solanum lycopersicum] Length = 476 Score = 40.0 bits (92), Expect(2) = 4e-07 Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = +1 Query: 280 LERKKEETLLMAFHVKEELE*D-IWYVDIGCSN 375 +E K+ ETLLMA HV++E + +WYVD GCSN Sbjct: 203 VENKEGETLLMAVHVEKEPDQQALWYVDTGCSN 235 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 173 DKSNVECYWCYNFGNYRSEC 232 DKS VECY C+ FG+YRSEC Sbjct: 169 DKSKVECYRCHKFGHYRSEC 188