BLASTX nr result
ID: Paeonia23_contig00037946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00037946 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048731.1| Pentatricopeptide repeat superfamily protein... 67 3e-09 ref|XP_007048729.1| Pentatricopeptide repeat superfamily protein... 67 3e-09 ref|XP_007048728.1| Pentatricopeptide repeat superfamily protein... 67 3e-09 ref|XP_002532784.1| pentatricopeptide repeat-containing protein,... 67 3e-09 emb|CBI26532.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat... 66 6e-09 ref|XP_007211611.1| hypothetical protein PRUPE_ppa005509mg [Prun... 59 7e-07 ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat... 56 6e-06 >ref|XP_007048731.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|590710091|ref|XP_007048732.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700992|gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700993|gb|EOX92889.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] Length = 490 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLRSGMKILKS+QRAV GL YSGF GEARK+++K+R+AR L++ Sbjct: 447 CLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 490 >ref|XP_007048729.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|590710083|ref|XP_007048730.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700990|gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700991|gb|EOX92887.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 457 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLRSGMKILKS+QRAV GL YSGF GEARK+++K+R+AR L++ Sbjct: 414 CLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 457 >ref|XP_007048728.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700989|gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 505 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLRSGMKILKS+QRAV GL YSGF GEARK+++K+R+AR L++ Sbjct: 462 CLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 505 >ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527472|gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLRSGMKIL S+QR V GL YSGF EARKL++K++LAR LHH Sbjct: 444 CLRSGMKILPSAQRVVISGLRYSGFQKEARKLKSKIKLARMLHH 487 >emb|CBI26532.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLR GMKIL+++QR+V DGL YSG++ EAR+L++K+RLAR LH+ Sbjct: 398 CLRGGMKILRANQRSVIDGLCYSGYTSEARRLKSKIRLARILHY 441 >ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Vitis vinifera] Length = 457 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLHH 174 CLR GMKIL+++QR+V DGL YSG++ EAR+L++K+RLAR LH+ Sbjct: 414 CLRGGMKILRANQRSVIDGLCYSGYTSEARRLKSKIRLARILHY 457 >ref|XP_007211611.1| hypothetical protein PRUPE_ppa005509mg [Prunus persica] gi|462407476|gb|EMJ12810.1| hypothetical protein PRUPE_ppa005509mg [Prunus persica] Length = 457 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLH 177 CLR G KI K++QRAVFDGL SGF+ EARKL K+R+AR LH Sbjct: 415 CLRHGKKIPKATQRAVFDGLYSSGFTNEARKLWWKIRVARILH 457 >ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum tuberosum] Length = 460 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLARTLH 177 C+R GM+ILKS +R V DGL SG+S EARK+++K+RLA LH Sbjct: 417 CIRGGMRILKSDKRGVIDGLRGSGYSQEARKVQSKIRLATILH 459 >ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449468117|ref|XP_004151768.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449532400|ref|XP_004173169.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] Length = 456 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 305 CLRSGMKILKSSQRAVFDGLLYSGFSGEARKLRTKVRLAR 186 C R GMK+LK+++RAV DGL SGF+ EARKL+ K+RLAR Sbjct: 414 CSRDGMKVLKATRRAVIDGLCSSGFTSEARKLKFKLRLAR 453