BLASTX nr result
ID: Paeonia23_contig00037813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00037813 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320456.2| hypothetical protein POPTR_0014s14950g, part... 66 4e-09 ref|XP_006386683.1| hypothetical protein POPTR_0002s18650g [Popu... 60 4e-07 >ref|XP_002320456.2| hypothetical protein POPTR_0014s14950g, partial [Populus trichocarpa] gi|550324232|gb|EEE98771.2| hypothetical protein POPTR_0014s14950g, partial [Populus trichocarpa] Length = 284 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +2 Query: 14 KYISKGKRQPLEQPVKFQAKGEPQILNLPAHDPQNWTNVIDVWKYT 151 +Y S+G R PLEQPVKF AK + QILN+ A DPQ W +V+D+WK T Sbjct: 11 RYRSRGSRMPLEQPVKFAAKNKGQILNITAQDPQQWNHVLDIWKDT 56 >ref|XP_006386683.1| hypothetical protein POPTR_0002s18650g [Populus trichocarpa] gi|550345324|gb|ERP64480.1| hypothetical protein POPTR_0002s18650g [Populus trichocarpa] Length = 233 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +2 Query: 17 YISKGKRQPLEQPVKFQAKGEPQILNLPAHDPQNWTNVIDVWKYT 151 Y KG PLE P+KF K E Q+LNL AHDPQ WT++IDVWK T Sbjct: 11 YRPKGSCVPLE-PIKFATKNEGQMLNLTAHDPQEWTHIIDVWKNT 54