BLASTX nr result
ID: Paeonia23_contig00037603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00037603 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [A... 57 3e-06 >ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda] gi|548855868|gb|ERN13731.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda] Length = 409 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = +3 Query: 3 LNGAFFTPXXXXXXXXXXXXXXXXXRPSSLVGPLTVAAGSLNCKKGSRC 149 LNGAFFTP RPSSLVG +TV+AG+LNCKKGSRC Sbjct: 361 LNGAFFTPSGAGASSSYNRASSLSARPSSLVGGITVSAGALNCKKGSRC 409