BLASTX nr result
ID: Paeonia23_contig00036774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00036774 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340801.1| PREDICTED: F-box protein At2g17036-like [Sol... 56 4e-06 ref|XP_004232540.1| PREDICTED: F-box protein At2g17036-like isof... 56 6e-06 ref|XP_004232539.1| PREDICTED: F-box protein At2g17036-like isof... 56 6e-06 >ref|XP_006340801.1| PREDICTED: F-box protein At2g17036-like [Solanum tuberosum] Length = 483 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +1 Query: 1 IECPIYQLKEAHDDEIGNENPSNSWLVKLEEDRYPKMHLMNPLS-RSLFQQVPKEFNLLK 177 IE +Y L+ D I ++P WL+++ + K+ ++NPL+ R + +PK NLL Sbjct: 81 IESTVYILQPLDGDSI--DSPCKGWLIQVIKTADGKLKVLNPLTGREIQNHMPKVLNLLD 138 Query: 178 FRVSEICKSYHLLF 219 FRVS++CKSYH+ + Sbjct: 139 FRVSQVCKSYHVQY 152 >ref|XP_004232540.1| PREDICTED: F-box protein At2g17036-like isoform 2 [Solanum lycopersicum] Length = 473 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = +1 Query: 1 IECPIYQLKEAHDDEIGNENPSNSWLVKLEEDRYPKMHLMNPLS-RSLFQQVPKEFNLLK 177 IE +Y + D I ++P WL+++ + K+ ++NPL+ R + +PK NLL Sbjct: 81 IESTVYIFQPLDGDSI--DSPCKGWLIQVIKTADGKLKVLNPLTGREIQNHMPKVLNLLD 138 Query: 178 FRVSEICKSYHLLF 219 FRVSE+CKSYH+ + Sbjct: 139 FRVSEVCKSYHVQY 152 >ref|XP_004232539.1| PREDICTED: F-box protein At2g17036-like isoform 1 [Solanum lycopersicum] Length = 486 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = +1 Query: 1 IECPIYQLKEAHDDEIGNENPSNSWLVKLEEDRYPKMHLMNPLS-RSLFQQVPKEFNLLK 177 IE +Y + D I ++P WL+++ + K+ ++NPL+ R + +PK NLL Sbjct: 81 IESTVYIFQPLDGDSI--DSPCKGWLIQVIKTADGKLKVLNPLTGREIQNHMPKVLNLLD 138 Query: 178 FRVSEICKSYHLLF 219 FRVSE+CKSYH+ + Sbjct: 139 FRVSEVCKSYHVQY 152