BLASTX nr result
ID: Paeonia23_contig00036698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00036698 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGE93464.1| ribulose 1,5-bisphosphate carboxylase/oxygenase l... 82 8e-14 gb|AFI24091.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 82 8e-14 ref|YP_008081658.1| ribulose bisphosphate carboxylase large chai... 81 2e-13 gb|AFI24088.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 81 2e-13 gb|AFI24033.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 81 2e-13 ref|XP_004987331.1| PREDICTED: LOW QUALITY PROTEIN: ribulose bis... 80 4e-13 ref|YP_007475969.1| ribulose 1,5-bisphosphate carboxylase/oxygen... 80 4e-13 ref|XP_004174160.1| PREDICTED: ribulose bisphosphate carboxylase... 80 4e-13 gb|AFM83301.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 gb|AAZ94659.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 tpg|DAA49738.1| TPA: hypothetical protein ZEAMMB73_563390 [Zea m... 80 4e-13 gb|AFW78859.1| ribulose bisphosphate carboxylase large chain Pre... 80 4e-13 gb|AFW63410.1| hypothetical protein ZEAMMB73_010834 [Zea mays] 80 4e-13 gb|AFA27693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 gb|AEX20158.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 gb|ADQ47556.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 gb|AAK97624.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 80 4e-13 gb|ABP35369.1| ORF493 [Pinus koraiensis] 79 5e-13 ref|YP_008854602.1| ribulose 1,5-bisphosphate carboxylase/oxygen... 79 7e-13 emb|CCW72383.1| ribulose-1,5-bisphosphate carboxylase/oxygenase ... 79 7e-13 >gb|AGE93464.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Xiphidium caeruleum] Length = 486 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDIL 44 >gb|AFI24091.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Photinia villosa] Length = 60 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDIL 44 >ref|YP_008081658.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium sinense] gi|512721415|ref|YP_008081736.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium tortisepalum] gi|482662104|gb|AGK25332.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium sinense] gi|482662183|gb|AGK25410.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium tortisepalum] gi|482662262|gb|AGK25488.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium tortisepalum] gi|482662499|gb|AGK25722.1| ribulose bisphosphate carboxylase large chain (chloroplast) [Cymbidium tortisepalum] Length = 487 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTP+YETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPDYETKDTDIL 44 >gb|AFI24088.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Photinia beauverdiana] Length = 60 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTP+YETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPQYETKDTDIL 44 >gb|AFI24033.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Osteomeles anthyllidifolia] gi|384598538|gb|AFI24034.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Osteomeles anthyllidifolia] gi|384598540|gb|AFI24035.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Osteomeles schwerinae] gi|384598542|gb|AFI24036.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Osteomeles schwerinae] gi|384598650|gb|AFI24089.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Photinia beauverdiana] gi|384598652|gb|AFI24090.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Photinia schneideriana var. parviflora] Length = 60 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTP+YETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPDYETKDTDIL 44 >ref|XP_004987331.1| PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase large chain-like [Setaria italica] Length = 364 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDXL 44 >ref|YP_007475969.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Bismarckia nobilis] gi|449326452|gb|AGE93034.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Bismarckia nobilis] Length = 487 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >ref|XP_004174160.1| PREDICTED: ribulose bisphosphate carboxylase large chain-like [Cucumis sativus] Length = 151 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AFM83301.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (chloroplast) [Kingia australis] Length = 486 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 REVLMSPQTETKAS GFKAGVKDYKL YYTP+YETKDTD L Sbjct: 4 REVLMSPQTETKASAGFKAGVKDYKLTYYTPDYETKDTDIL 44 >gb|AAZ94659.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Cucumis sativus] Length = 482 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >tpg|DAA49738.1| TPA: hypothetical protein ZEAMMB73_563390 [Zea mays] Length = 190 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AFW78859.1| ribulose bisphosphate carboxylase large chain Precursor [Zea mays] gi|414590289|tpg|DAA40860.1| TPA: ribulose bisphosphate carboxylase large chain Precursor [Zea mays] gi|414870046|tpg|DAA48603.1| TPA: ribulose bisphosphate carboxylase large chain Precursor [Zea mays] Length = 483 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AFW63410.1| hypothetical protein ZEAMMB73_010834 [Zea mays] Length = 190 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AFA27693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Potarophytum riparium] Length = 486 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AEX20158.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Acanthostachys strobilacea] gi|369720194|gb|AEX20159.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea bromeliifolia] gi|369720196|gb|AEX20160.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea drakeana] gi|369720198|gb|AEX20161.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea haltonii] gi|369720200|gb|AEX20162.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea lingulata] gi|369720202|gb|AEX20163.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea organensis] gi|369720204|gb|AEX20164.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea racinae] gi|369720206|gb|AEX20165.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Ananas ananassoides] gi|369720208|gb|AEX20166.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Ananas nanus] gi|369720210|gb|AEX20167.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Araeococcus goeldianus] gi|369720212|gb|AEX20168.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Araeococcus pectinatus] gi|369720214|gb|AEX20169.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Billbergia decora] gi|369720226|gb|AEX20175.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Nidularium billbergioides] gi|369720228|gb|AEX20176.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Canistrum aurantiacum] gi|369720230|gb|AEX20177.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Chevaliera sphaerocephala] gi|369720234|gb|AEX20179.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Cryptanthus beuckeri] gi|369720248|gb|AEX20186.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Edmundoa perplexa] gi|369720250|gb|AEX20187.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Eduandrea selloana] gi|369720274|gb|AEX20199.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Hohenbergia stellata] gi|369720278|gb|AEX20201.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Lymania alvimii] gi|369720288|gb|AEX20206.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Neoregelia pineliana] gi|369720310|gb|AEX20217.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Pseudananas sagenarius] gi|369720320|gb|AEX20222.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Quesnelia quesneliana] gi|369720322|gb|AEX20223.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Rapatea paludosa] gi|369720324|gb|AEX20224.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Aechmea allenii] gi|369720342|gb|AEX20233.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Canistrum superbum] Length = 69 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|ADQ47556.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Ampelopsis delavayana] gi|384598478|gb|AFI24005.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598480|gb|AFI24006.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598482|gb|AFI24007.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598484|gb|AFI24008.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598486|gb|AFI24009.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598488|gb|AFI24010.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles speciosa] gi|384598490|gb|AFI24011.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles cathayensis] gi|384598492|gb|AFI24012.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles cathayensis] gi|384598494|gb|AFI24013.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Chaenomeles japonica] gi|384598524|gb|AFI24027.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Pseudocydonia sinensis] gi|384598574|gb|AFI24052.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Malus coronaria var. glaucescens] gi|384598576|gb|AFI24053.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Malus ioensis] gi|384598578|gb|AFI24054.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Malus x platycarpa] gi|384598580|gb|AFI24055.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Malus angustifolia] gi|384598582|gb|AFI24056.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Malus coronaria var. glabrata] gi|384598673|gb|AFI24100.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Crataegus succulenta] gi|384598675|gb|AFI24101.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Crataegus monogyna] Length = 60 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKL YYTPEYETKDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDIL 44 >gb|AAK97624.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Ficaria verna] Length = 63 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTPEY KDTDTL Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPEYTPKDTDTL 44 >gb|ABP35369.1| ORF493 [Pinus koraiensis] Length = 493 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -3 Query: 157 CENS*IQKLIVREVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 CE S L+++E LMSP+TETKASVGFKAGVKDY+L YYTPEY+TKDTD L Sbjct: 8 CEKS----LLIKEGLMSPKTETKASVGFKAGVKDYRLTYYTPEYQTKDTDIL 55 >ref|YP_008854602.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Curcuma roscoeana] gi|557637509|gb|AHA13104.1| ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit [Curcuma roscoeana] Length = 487 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTP+YE KDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPDYEVKDTDIL 44 >emb|CCW72383.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (chloroplast) [Musa acuminata subsp. malaccensis] Length = 487 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 124 REVLMSPQTETKASVGFKAGVKDYKLNYYTPEYETKDTDTL 2 RE LMSPQTETKASVGFKAGVKDYKLNYYTP+YE KDTD L Sbjct: 4 REGLMSPQTETKASVGFKAGVKDYKLNYYTPDYEVKDTDIL 44