BLASTX nr result
ID: Paeonia23_contig00036647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00036647 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004500899.1| PREDICTED: prolyl endopeptidase-like [Cicer ... 64 2e-08 ref|XP_003545007.2| PREDICTED: prolyl endopeptidase-like [Glycin... 62 6e-08 ref|XP_003523219.1| PREDICTED: prolyl endopeptidase-like [Glycin... 62 8e-08 ref|XP_006390232.1| hypothetical protein EUTSA_v10018135mg [Eutr... 61 1e-07 ref|XP_006390231.1| hypothetical protein EUTSA_v10018135mg [Eutr... 61 1e-07 ref|XP_006301553.1| hypothetical protein CARUB_v10021987mg [Caps... 61 1e-07 gb|AAF17627.1|AC009978_3 T23E18.7 [Arabidopsis thaliana] 61 1e-07 ref|NP_177741.3| prolyl oligopeptidase [Arabidopsis thaliana] gi... 61 1e-07 ref|NP_001117606.1| prolyl oligopeptidase [Arabidopsis thaliana]... 61 1e-07 gb|AAL86330.1| putative prolyl endopeptidase [Arabidopsis thaliana] 61 1e-07 ref|XP_002301932.2| hypothetical protein POPTR_0002s01530g [Popu... 60 3e-07 ref|XP_004291316.1| PREDICTED: prolyl endopeptidase-like [Fragar... 60 3e-07 ref|XP_007227012.1| hypothetical protein PRUPE_ppa001441mg [Prun... 60 3e-07 gb|EYU17544.1| hypothetical protein MIMGU_mgv1a001978mg [Mimulus... 60 4e-07 ref|XP_007136135.1| hypothetical protein PHAVU_009G020800g [Phas... 60 4e-07 ref|XP_007017945.1| Prolyl oligopeptidase family protein [Theobr... 60 4e-07 ref|XP_006828887.1| hypothetical protein AMTR_s00001p00185410 [A... 59 5e-07 ref|XP_004145530.1| PREDICTED: prolyl endopeptidase-like [Cucumi... 59 5e-07 gb|ADN34133.1| serine-type endopeptidase [Cucumis melo subsp. melo] 59 5e-07 ref|XP_002887627.1| prolyl oligopeptidase [Arabidopsis lyrata su... 59 5e-07 >ref|XP_004500899.1| PREDICTED: prolyl endopeptidase-like [Cicer arietinum] Length = 728 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 VEP TLSWV FS+ISWT+DSKGFFY RYP PK +V+ T Sbjct: 167 VEPDTLSWVKFSSISWTHDSKGFFYSRYPAPKEGEVVDAGTET 209 >ref|XP_003545007.2| PREDICTED: prolyl endopeptidase-like [Glycine max] Length = 762 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 V+P TLSWV FS+ISWT+D+KGFFY RYP PK LV+ T Sbjct: 201 VQPDTLSWVKFSSISWTHDTKGFFYSRYPAPKDGELVDAGTET 243 >ref|XP_003523219.1| PREDICTED: prolyl endopeptidase-like [Glycine max] Length = 727 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 VEP TLSWV FS+ISWT+D KGFFY RYP PK +V+ T Sbjct: 166 VEPDTLSWVKFSSISWTHDGKGFFYSRYPAPKDGEVVDAGTET 208 >ref|XP_006390232.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum] gi|557086666|gb|ESQ27518.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum] Length = 804 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TL+WV FS I+WT+DSKGFFYGRYP PK Sbjct: 243 VEPDTLAWVKFSGIAWTHDSKGFFYGRYPAPK 274 >ref|XP_006390231.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum] gi|557086665|gb|ESQ27517.1| hypothetical protein EUTSA_v10018135mg [Eutrema salsugineum] Length = 711 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TL+WV FS I+WT+DSKGFFYGRYP PK Sbjct: 150 VEPDTLAWVKFSGIAWTHDSKGFFYGRYPAPK 181 >ref|XP_006301553.1| hypothetical protein CARUB_v10021987mg [Capsella rubella] gi|482570263|gb|EOA34451.1| hypothetical protein CARUB_v10021987mg [Capsella rubella] Length = 796 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 235 VEPDTLSWVKFTGITWTHDSKGFFYGRYPAPK 266 >gb|AAF17627.1|AC009978_3 T23E18.7 [Arabidopsis thaliana] Length = 650 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 234 VEPDTLSWVKFTGITWTHDSKGFFYGRYPAPK 265 >ref|NP_177741.3| prolyl oligopeptidase [Arabidopsis thaliana] gi|332197680|gb|AEE35801.1| prolyl oligopeptidase [Arabidopsis thaliana] Length = 795 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 234 VEPDTLSWVKFTGITWTHDSKGFFYGRYPAPK 265 >ref|NP_001117606.1| prolyl oligopeptidase [Arabidopsis thaliana] gi|332197681|gb|AEE35802.1| prolyl oligopeptidase [Arabidopsis thaliana] Length = 792 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 234 VEPDTLSWVKFTGITWTHDSKGFFYGRYPAPK 265 >gb|AAL86330.1| putative prolyl endopeptidase [Arabidopsis thaliana] Length = 757 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 196 VEPDTLSWVKFTGITWTHDSKGFFYGRYPAPK 227 >ref|XP_002301932.2| hypothetical protein POPTR_0002s01530g [Populus trichocarpa] gi|550344058|gb|EEE81205.2| hypothetical protein POPTR_0002s01530g [Populus trichocarpa] Length = 733 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VE TL+WV F++I+WT+DSKGFFYGRYPTPK Sbjct: 172 VEADTLNWVKFTSINWTHDSKGFFYGRYPTPK 203 >ref|XP_004291316.1| PREDICTED: prolyl endopeptidase-like [Fragaria vesca subsp. vesca] Length = 730 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP TLSWV FS ISWT+D+KGFFY RYP PK Sbjct: 171 VEPDTLSWVKFSGISWTHDNKGFFYSRYPAPK 202 >ref|XP_007227012.1| hypothetical protein PRUPE_ppa001441mg [Prunus persica] gi|462423948|gb|EMJ28211.1| hypothetical protein PRUPE_ppa001441mg [Prunus persica] Length = 828 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 +EP TLSWV FS ISWT+D+KGFFY RYP PK + ++ T Sbjct: 267 IEPDTLSWVKFSGISWTHDNKGFFYSRYPAPKEGKDIDAGTET 309 >gb|EYU17544.1| hypothetical protein MIMGU_mgv1a001978mg [Mimulus guttatus] Length = 731 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 +EP T+SWV FS+ISWT+DSKGFFY RYP P+ Sbjct: 170 IEPDTISWVKFSSISWTHDSKGFFYSRYPAPE 201 >ref|XP_007136135.1| hypothetical protein PHAVU_009G020800g [Phaseolus vulgaris] gi|561009222|gb|ESW08129.1| hypothetical protein PHAVU_009G020800g [Phaseolus vulgaris] Length = 730 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 VEP TL WV FS+ISWT+D+KGFFY RYP PK +V+ T Sbjct: 170 VEPDTLMWVKFSSISWTHDNKGFFYSRYPAPKDGDVVDAGTET 212 >ref|XP_007017945.1| Prolyl oligopeptidase family protein [Theobroma cacao] gi|508723273|gb|EOY15170.1| Prolyl oligopeptidase family protein [Theobroma cacao] Length = 789 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 6 EPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 EP TLSWV FS ISWT+DSKGFFY RYP PK Sbjct: 229 EPDTLSWVKFSGISWTHDSKGFFYSRYPAPK 259 >ref|XP_006828887.1| hypothetical protein AMTR_s00001p00185410 [Amborella trichopoda] gi|548833866|gb|ERM96303.1| hypothetical protein AMTR_s00001p00185410 [Amborella trichopoda] Length = 731 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 6 EPATLSWVNFSTISWTYDSKGFFYGRYPTP 95 EP TL WV FS+ISWT+DSKGFFYGRYP P Sbjct: 171 EPDTLKWVKFSSISWTHDSKGFFYGRYPKP 200 >ref|XP_004145530.1| PREDICTED: prolyl endopeptidase-like [Cucumis sativus] Length = 731 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +3 Query: 6 EPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 EP TLSWV FS+ISWT D KGFFY RYP PK + ++ T Sbjct: 171 EPDTLSWVKFSSISWTVDGKGFFYSRYPAPKEVGTLDAGTET 212 >gb|ADN34133.1| serine-type endopeptidase [Cucumis melo subsp. melo] Length = 731 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +3 Query: 6 EPATLSWVNFSTISWTYDSKGFFYGRYPTPKRLRLVEGRPRT 131 EP TLSWV FS+ISWT D KGFFY RYP PK + ++ T Sbjct: 171 EPDTLSWVKFSSISWTVDGKGFFYSRYPAPKEVGTLDAGTET 212 >ref|XP_002887627.1| prolyl oligopeptidase [Arabidopsis lyrata subsp. lyrata] gi|297333468|gb|EFH63886.1| prolyl oligopeptidase [Arabidopsis lyrata subsp. lyrata] Length = 794 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 3 VEPATLSWVNFSTISWTYDSKGFFYGRYPTPK 98 VEP LSWV F+ I+WT+DSKGFFYGRYP PK Sbjct: 234 VEPDVLSWVKFTGITWTHDSKGFFYGRYPAPK 265