BLASTX nr result
ID: Paeonia23_contig00035768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035768 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001560073.1| hypothetical protein BC1G_01632 [Botryotinia... 60 4e-07 gb|ESZ98761.1| hypothetical protein SBOR_0867 [Sclerotinia borea... 59 5e-07 >ref|XP_001560073.1| hypothetical protein BC1G_01632 [Botryotinia fuckeliana B05.10] gi|347831008|emb|CCD46705.1| hypothetical protein BofuT4_P043160.1 [Botryotinia fuckeliana T4] gi|472244825|gb|EMR89427.1| putative mitochondrial hypoxia responsive domain-containing protein [Botryotinia fuckeliana BcDW1] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/67 (47%), Positives = 42/67 (62%) Frame = -2 Query: 391 HHVSTKQHKGKEAKDKIVSESSKGAGKVDYAEAEEKERKNSERQSEKEGDARRSATADGA 212 +H S K GKE KDKI SE K AGKV +A+A+E+E KN Q+EKE DA+ +T Sbjct: 233 NHSSGKTSSGKENKDKISSEM-KSAGKVAFADAQEREDKNQAEQAEKEADAKHESTQSEP 291 Query: 211 KVQDRGE 191 KV + + Sbjct: 292 KVNGKNK 298 >gb|ESZ98761.1| hypothetical protein SBOR_0867 [Sclerotinia borealis F-4157] Length = 299 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = -2 Query: 394 EHHVSTKQHKGKEAKDKIVSESSKGAGKVDYAEAEEKERKNSERQSEKEGDARRSATADG 215 + H S K KGKE KDKI SE K AGKV +A+A+E+E KN Q+EKE DAR + Sbjct: 232 KRHSSGKMAKGKENKDKISSEM-KSAGKVAFADAKEREDKNQAEQAEKEADARNESAQAE 290 Query: 214 AKVQDRGE 191 ++ R + Sbjct: 291 PQINGRNQ 298