BLASTX nr result
ID: Paeonia23_contig00035756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035756 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containi... 135 8e-30 ref|XP_004305084.1| PREDICTED: pentatricopeptide repeat-containi... 122 5e-26 ref|XP_004137888.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 gb|EXB67237.1| hypothetical protein L484_025716 [Morus notabilis] 113 3e-23 emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] 109 4e-22 ref|XP_007157299.1| hypothetical protein PHAVU_002G058400g [Phas... 105 7e-21 ref|XP_003609024.1| Pentatricopeptide repeat-containing protein ... 100 2e-19 ref|XP_003607207.1| Pentatricopeptide repeat-containing protein ... 100 2e-19 ref|XP_004505733.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_003522599.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_006829784.1| hypothetical protein AMTR_s00119p00048520 [A... 98 1e-18 ref|XP_007020439.1| Tetratricopeptide repeat-like superfamily pr... 96 7e-18 emb|CBI15206.3| unnamed protein product [Vitis vinifera] 96 7e-18 ref|XP_007207083.1| hypothetical protein PRUPE_ppa024338mg, part... 95 9e-18 gb|EMT11227.1| hypothetical protein F775_16951 [Aegilops tauschii] 95 1e-17 ref|NP_001078414.1| pentatricopeptide repeat-containing protein ... 94 2e-17 ref|NP_001078415.1| pentatricopeptide repeat-containing protein ... 94 2e-17 emb|CAB45902.1| putative protein (fragment) [Arabidopsis thalian... 94 2e-17 emb|CAA17526.1| putative protein (fragment) [Arabidopsis thaliana] 94 2e-17 ref|XP_006363979.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 >ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 636 Score = 135 bits (339), Expect = 8e-30 Identities = 63/82 (76%), Positives = 73/82 (89%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 KTMPF ANS+LWRTLLGACRVH + +LAEE F QL ++E L+DGDYVLLSN+YAEA+RWN Sbjct: 551 KTMPFEANSVLWRTLLGACRVHHHVDLAEESFQQLGKMEPLRDGDYVLLSNIYAEAQRWN 610 Query: 182 DVERVRNEMICSGVSKKPGSSN 247 DVERVR+EMI SGV KKPGSS+ Sbjct: 611 DVERVRSEMIGSGVPKKPGSSH 632 >ref|XP_004305084.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 537 Score = 122 bits (306), Expect = 5e-26 Identities = 55/82 (67%), Positives = 68/82 (82%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K +P ANS+LWRTLLGAC+VH N ELAE+CF QLA+LE L+D DYVLLSN+YAEAK+W+ Sbjct: 452 KAVPSMANSLLWRTLLGACKVHGNVELAEQCFEQLAKLEPLKDADYVLLSNIYAEAKKWD 511 Query: 182 DVERVRNEMICSGVSKKPGSSN 247 V+R+RNEM+C GV K G S+ Sbjct: 512 GVQRLRNEMVCKGVPKSLGFSH 533 >ref|XP_004137888.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] gi|449521725|ref|XP_004167880.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 521 Score = 114 bits (284), Expect = 2e-23 Identities = 54/82 (65%), Positives = 66/82 (80%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 KT PF++ S+LWRTLLG CR+H + EL EE F +LAELE +DGDYVLLSN+YAE +RW+ Sbjct: 439 KTCPFSSCSVLWRTLLGGCRLHRHVELGEESFRKLAELEPGKDGDYVLLSNIYAEEERWD 498 Query: 182 DVERVRNEMICSGVSKKPGSSN 247 DVER+R EMI GV KK GSS+ Sbjct: 499 DVERLRKEMINYGVCKKAGSSH 520 >gb|EXB67237.1| hypothetical protein L484_025716 [Morus notabilis] Length = 537 Score = 113 bits (282), Expect = 3e-23 Identities = 52/82 (63%), Positives = 67/82 (81%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 + +P +S+LWRTLLGACRVH N +LAE+CF QLAELE L+D DYVLLSN+YAEA+RW+ Sbjct: 453 ENVPPQISSVLWRTLLGACRVHGNVDLAEKCFQQLAELEPLKDADYVLLSNIYAEAERWD 512 Query: 182 DVERVRNEMICSGVSKKPGSSN 247 DVER+R++M+ GV K G S+ Sbjct: 513 DVERLRDDMVSRGVVKILGYSH 534 >emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] Length = 633 Score = 109 bits (273), Expect = 4e-22 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 KTMPF ANS+LWRTLLGACRVH + +LAEE F QL ++E L+DGDYVLLSN+YAEA+RWN Sbjct: 445 KTMPFEANSVLWRTLLGACRVHHHVDLAEESFQQLGKMEPLRDGDYVLLSNIYAEAQRWN 504 Query: 182 DVER 193 DVER Sbjct: 505 DVER 508 >ref|XP_007157299.1| hypothetical protein PHAVU_002G058400g [Phaseolus vulgaris] gi|561030714|gb|ESW29293.1| hypothetical protein PHAVU_002G058400g [Phaseolus vulgaris] Length = 536 Score = 105 bits (262), Expect = 7e-21 Identities = 52/78 (66%), Positives = 61/78 (78%) Frame = +2 Query: 11 PFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWNDVE 190 PF +ILWRTLLGACR N ELA+ F QL +L+SL DGDYVLLSN+YAEA+RW++VE Sbjct: 447 PFQNRAILWRTLLGACRTQVNVELAKVSFQQLVKLKSLTDGDYVLLSNIYAEAERWDEVE 506 Query: 191 RVRNEMICSGVSKKPGSS 244 RVR+EMI VSKK G S Sbjct: 507 RVRSEMIDLHVSKKVGHS 524 >ref|XP_003609024.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510079|gb|AES91221.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 544 Score = 100 bits (250), Expect = 2e-19 Identities = 50/80 (62%), Positives = 61/80 (76%) Frame = +2 Query: 5 TMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWND 184 T PF + +LWRTLLGACR SNTELAE F QLA+L+ L DGDYVLLSN+YAEA RW++ Sbjct: 454 TAPFQNSVVLWRTLLGACRTQSNTELAEISFKQLAKLKQLIDGDYVLLSNIYAEAGRWDE 513 Query: 185 VERVRNEMICSGVSKKPGSS 244 VER+R+EM V ++ G S Sbjct: 514 VERLRSEMDYLHVPRQAGYS 533 >ref|XP_003607207.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508262|gb|AES89404.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 542 Score = 100 bits (250), Expect = 2e-19 Identities = 50/80 (62%), Positives = 61/80 (76%) Frame = +2 Query: 5 TMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWND 184 T PF + +LWRTLLGACR SNTELAE F QLA+L+ L DGDYVLLSN+YAEA RW++ Sbjct: 452 TAPFQNSVVLWRTLLGACRTQSNTELAEISFKQLAKLKQLIDGDYVLLSNIYAEAGRWDE 511 Query: 185 VERVRNEMICSGVSKKPGSS 244 VER+R+EM V ++ G S Sbjct: 512 VERLRSEMDYLHVPRQAGYS 531 >ref|XP_004505733.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cicer arietinum] Length = 544 Score = 100 bits (248), Expect = 3e-19 Identities = 49/81 (60%), Positives = 59/81 (72%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 KT PF + +LWRTLLGACR +N ELA+ F QLA+ E L GDYVLLSN+YAEA RW+ Sbjct: 453 KTAPFQNSEVLWRTLLGACRTQANMELAKISFQQLAKFEQLTIGDYVLLSNIYAEAGRWD 512 Query: 182 DVERVRNEMICSGVSKKPGSS 244 +VER+RNEM V K+ G S Sbjct: 513 EVERLRNEMDYLNVPKEAGYS 533 >ref|XP_003522599.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] Length = 535 Score = 100 bits (248), Expect = 3e-19 Identities = 49/77 (63%), Positives = 59/77 (76%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 KT P ++ILWRTLLGACR N ELA+ F QLA+L L DGDYVLLSN+YAEA+RW+ Sbjct: 444 KTAPLQNSAILWRTLLGACRTQGNVELAKVSFQQLAKLGRLTDGDYVLLSNIYAEAERWD 503 Query: 182 DVERVRNEMICSGVSKK 232 +VERVR+EMI V K+ Sbjct: 504 EVERVRSEMIGLHVPKQ 520 >ref|XP_006829784.1| hypothetical protein AMTR_s00119p00048520 [Amborella trichopoda] gi|548835365|gb|ERM97200.1| hypothetical protein AMTR_s00119p00048520 [Amborella trichopoda] Length = 373 Score = 98.2 bits (243), Expect = 1e-18 Identities = 49/79 (62%), Positives = 55/79 (69%) Frame = +2 Query: 8 MPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWNDV 187 MPF+AN+I WRTLLGA R N ELAE L LE L+ GDYVLLSN+Y EA RW+DV Sbjct: 289 MPFDANTIRWRTLLGASRTRENVELAEVLVENLGRLEPLKHGDYVLLSNIYVEAYRWDDV 348 Query: 188 ERVRNEMICSGVSKKPGSS 244 ERVR M+ GV K PG S Sbjct: 349 ERVRQMMVEMGVLKPPGFS 367 >ref|XP_007020439.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508720067|gb|EOY11964.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 615 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 1/88 (1%) Frame = +2 Query: 8 MPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWNDV 187 MP N ++W LLG C+VH N +LAEE LA+L+ L DG YV+LSN+YAEA+RW DV Sbjct: 406 MPIKPNGVVWGALLGGCKVHKNIKLAEEATRHLAQLDPLNDGYYVVLSNIYAEAERWEDV 465 Query: 188 ERVRNEMICSGVSKKPG-SSNF*DGIMN 268 RVR M GV K PG SS DG+++ Sbjct: 466 ARVRKRMKNRGVKKTPGCSSIVVDGVIH 493 >emb|CBI15206.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 95.5 bits (236), Expect = 7e-18 Identities = 49/82 (59%), Positives = 57/82 (69%), Gaps = 1/82 (1%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K+MP +NSI+WRTLL ACRVH N ELAE+ QL ELE DYVLL+N+YA A +WN Sbjct: 314 KSMPIESNSIVWRTLLAACRVHGNLELAEQVRQQLLELEPDHSSDYVLLANMYASAGQWN 373 Query: 182 DVERVRNEMICSGVSK-KPGSS 244 V RVR M GV K KPG+S Sbjct: 374 KVVRVRKSMHIRGVQKPKPGNS 395 >ref|XP_007207083.1| hypothetical protein PRUPE_ppa024338mg, partial [Prunus persica] gi|462402725|gb|EMJ08282.1| hypothetical protein PRUPE_ppa024338mg, partial [Prunus persica] Length = 611 Score = 95.1 bits (235), Expect = 9e-18 Identities = 49/88 (55%), Positives = 59/88 (67%), Gaps = 1/88 (1%) Frame = +2 Query: 8 MPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWNDV 187 MP NSI+W LLG C+VH N ELAEE L+EL+ L DG YV+LSN+YAEA+RW D Sbjct: 402 MPIKPNSIVWGALLGGCKVHRNIELAEEATKHLSELDPLNDGYYVVLSNIYAEAQRWEDT 461 Query: 188 ERVRNEMICSGVSKKPG-SSNF*DGIMN 268 RVR M GV K PG SS DG+++ Sbjct: 462 ARVRKLMRDRGVKKTPGWSSITVDGVIH 489 >gb|EMT11227.1| hypothetical protein F775_16951 [Aegilops tauschii] Length = 903 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/81 (51%), Positives = 55/81 (67%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K MP +++W LL ACRVHSN ELAE ++L E+ + DG Y L+SN+YA A+RW Sbjct: 692 KDMPMEPTAVVWVALLSACRVHSNVELAEYALNKLVEMNAENDGSYTLISNIYANARRWK 751 Query: 182 DVERVRNEMICSGVSKKPGSS 244 DV R+RN M SG+ K+PG S Sbjct: 752 DVARIRNLMKNSGIKKRPGCS 772 >ref|NP_001078414.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635630|sp|A8MQA3.2|PP330_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21065 gi|332658994|gb|AEE84394.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 595 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/81 (51%), Positives = 58/81 (71%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K+MP N ++WRTLLGAC VH +++LAE Q+ +LE GDYVLLSN+YA +RW+ Sbjct: 384 KSMPMQPNVVIWRTLLGACTVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWS 443 Query: 182 DVERVRNEMICSGVSKKPGSS 244 DV+++R +M+ GV K PG S Sbjct: 444 DVQKIRKQMLRDGVKKVPGHS 464 >ref|NP_001078415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658995|gb|AEE84395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 462 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/81 (51%), Positives = 58/81 (71%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K+MP N ++WRTLLGAC VH +++LAE Q+ +LE GDYVLLSN+YA +RW+ Sbjct: 251 KSMPMQPNVVIWRTLLGACTVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWS 310 Query: 182 DVERVRNEMICSGVSKKPGSS 244 DV+++R +M+ GV K PG S Sbjct: 311 DVQKIRKQMLRDGVKKVPGHS 331 >emb|CAB45902.1| putative protein (fragment) [Arabidopsis thaliana] gi|7268904|emb|CAB79107.1| putative protein (fragment) [Arabidopsis thaliana] Length = 1495 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/81 (51%), Positives = 58/81 (71%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K+MP N ++WRTLLGAC VH +++LAE Q+ +LE GDYVLLSN+YA +RW+ Sbjct: 384 KSMPMQPNVVIWRTLLGACTVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWS 443 Query: 182 DVERVRNEMICSGVSKKPGSS 244 DV+++R +M+ GV K PG S Sbjct: 444 DVQKIRKQMLRDGVKKVPGHS 464 >emb|CAA17526.1| putative protein (fragment) [Arabidopsis thaliana] Length = 1331 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/81 (51%), Positives = 58/81 (71%) Frame = +2 Query: 2 KTMPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWN 181 K+MP N ++WRTLLGAC VH +++LAE Q+ +LE GDYVLLSN+YA +RW+ Sbjct: 167 KSMPMQPNVVIWRTLLGACTVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWS 226 Query: 182 DVERVRNEMICSGVSKKPGSS 244 DV+++R +M+ GV K PG S Sbjct: 227 DVQKIRKQMLRDGVKKVPGHS 247 >ref|XP_006363979.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860-like isoform X1 [Solanum tuberosum] gi|565396768|ref|XP_006363980.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860-like isoform X2 [Solanum tuberosum] Length = 843 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/79 (55%), Positives = 54/79 (68%) Frame = +2 Query: 8 MPFNANSILWRTLLGACRVHSNTELAEECFHQLAELESLQDGDYVLLSNVYAEAKRWNDV 187 MP S++W LL ACRVH N +LAE +L+ELES DG Y LLSN+YA AKRW DV Sbjct: 634 MPMEPTSVVWVALLSACRVHKNVDLAEHAAAKLSELESENDGTYTLLSNIYANAKRWKDV 693 Query: 188 ERVRNEMICSGVSKKPGSS 244 R+R+ M SG+ K+PG S Sbjct: 694 ARIRSLMKHSGIRKRPGCS 712