BLASTX nr result
ID: Paeonia23_contig00035726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035726 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGX27512.1| ACA13 [Populus tomentosa] 59 7e-07 emb|CBI26329.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002279864.1| PREDICTED: putative calcium-transporting ATP... 56 5e-06 >gb|AGX27512.1| ACA13 [Populus tomentosa] Length = 1006 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 104 NIECIEYLLHVPATLSKSYKRWHLAFATIYCSRT 3 N+ CIE LL VPATLSK KRWHL FATIYCSRT Sbjct: 8 NLVCIERLLDVPATLSKPNKRWHLVFATIYCSRT 41 >emb|CBI26329.3| unnamed protein product [Vitis vinifera] Length = 4083 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 104 NIECIEYLLHVPATLSKSYKRWHLAFATIYCSR 6 N+ CIE +L VP+TLSK KRWHLAFATIYC+R Sbjct: 859 NLNCIESILDVPSTLSKPNKRWHLAFATIYCAR 891 >ref|XP_002279864.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Vitis vinifera] Length = 1012 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 104 NIECIEYLLHVPATLSKSYKRWHLAFATIYCSR 6 N+ CIE +L VP+TLSK KRWHLAFATIYC+R Sbjct: 8 NLNCIESILDVPSTLSKPNKRWHLAFATIYCAR 40