BLASTX nr result
ID: Paeonia23_contig00035469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035469 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB60132.1| hypothetical protein L484_013397 [Morus notabilis] 60 2e-07 >gb|EXB60132.1| hypothetical protein L484_013397 [Morus notabilis] Length = 263 Score = 60.5 bits (145), Expect = 2e-07 Identities = 40/116 (34%), Positives = 60/116 (51%), Gaps = 15/116 (12%) Frame = +3 Query: 6 VVGVGIDKLVNNLQKESNDLSIPTLVESSELAGDEMGGQG----------NDFSRYTLEK 155 VVGVGIDK ++K+ + VE +LA G G DFSR+ L + Sbjct: 130 VVGVGIDKFGKKMEKDYGWMMPNKAVELRDLAAQLRGNNGTPNNPDGQTTRDFSRFGLAR 189 Query: 156 FTKEVLGGEMGKILKPNKMIWWDQGQRNHW-----RLLSDDLVNYANMEAFLASEM 308 + VLG E+ +KPN++ W + +HW + L+ D++ YA++EAFL S M Sbjct: 190 LARAVLGEEV-NFVKPNRITWCN----SHWIPCYPQRLTKDMIKYASVEAFLTSYM 240