BLASTX nr result
ID: Paeonia23_contig00035406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035406 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524814.1| exonuclease, putative [Ricinus communis] gi|... 59 9e-07 >ref|XP_002524814.1| exonuclease, putative [Ricinus communis] gi|223535998|gb|EEF37657.1| exonuclease, putative [Ricinus communis] Length = 365 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 31 FDYLKPSELEIMTPDELFAMSRSNYKCWCLDSR 129 FD LKP ELE MT DEL+ +SRSNYKCWCLDS+ Sbjct: 328 FDSLKPKELESMTSDELYDISRSNYKCWCLDSK 360