BLASTX nr result
ID: Paeonia23_contig00035315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035315 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62038.1| hypothetical protein VITISV_021371 [Vitis vinifera] 60 3e-07 >emb|CAN62038.1| hypothetical protein VITISV_021371 [Vitis vinifera] Length = 1123 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -2 Query: 244 TAKTKCQVRYVVKKPDDISKEERISQKGRRSWLVFFNETDY 122 T KT CQV VVK DDI KE +IS+K RR WLVFFNETDY Sbjct: 232 TVKTGCQVLSVVKNIDDIGKEGKISRKTRRRWLVFFNETDY 272