BLASTX nr result
ID: Paeonia23_contig00035216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035216 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999602.1| cytochrome c biogenesis FC (mitochondrion) [... 75 1e-11 emb|CAA54966.1| unnamed protein product [Oenothera berteroana] g... 74 2e-11 ref|YP_002608185.2| cytochrome c biogenesis FC [Carica papaya] g... 74 2e-11 ref|YP_006666108.1| CcmFC (mitochondrion) [Malus domestica] gi|4... 72 6e-11 dbj|BAO50895.1| cytochrome c biogenesis FC (mitochondrion) [Heve... 72 8e-11 gb|AGC78967.1| hypothetical protein (mitochondrion) [Vicia faba]... 72 8e-11 gb|AGC78965.1| cytochrome c biogenesis FC (mitochondrion) [Vicia... 72 8e-11 ref|YP_007516870.1| cytochrome c biogenesis FC (mitochondrion) [... 72 8e-11 ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 72 8e-11 ref|YP_004237254.1| cytochrome c biogenesis FC (mitochondrion) [... 72 8e-11 ref|YP_004222809.1| cytochrome c biogenesis FC [Vigna radiata] g... 72 8e-11 ref|XP_002534941.1| conserved hypothetical protein [Ricinus comm... 72 8e-11 gb|AGK25078.1| cytochrome c biogenesis FC, partial (mitochondrio... 71 1e-10 ref|YP_007905719.1| cytochrome c biogenesis FC (mitochondrion) [... 71 1e-10 ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus c... 71 2e-10 ref|YP_006280948.1| cytochrome c biogenesis FC (mitochondrion) [... 71 2e-10 ref|XP_006396157.1| hypothetical protein EUTSA_v10002931mg [Eutr... 70 4e-10 gb|AEX57643.1| CcmFC (mitochondrion) [Raphanus sativus] gi|44329... 70 4e-10 ref|YP_006665991.1| cytochrome c biogenesis protein ccmFC (mitoc... 70 4e-10 dbj|BAM36190.1| cytochrome c biogenesis protein ccmFC (mitochond... 70 4e-10 >ref|YP_008999602.1| cytochrome c biogenesis FC (mitochondrion) [Vaccinium macrocarpon] gi|549531676|gb|AGX28815.1| cytochrome c biogenesis FC (mitochondrion) [Vaccinium macrocarpon] Length = 423 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT FPLLVYL+SRKFICS D K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPPFPLLVYLHSRKFICSTDGAK 72 >emb|CAA54966.1| unnamed protein product [Oenothera berteroana] gi|1581174|prf||2116373A ORF 454 Length = 454 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|YP_002608185.2| cytochrome c biogenesis FC [Carica papaya] gi|257057918|gb|ACB20474.2| cytochrome c biogenesis FC (mitochondrion) [Carica papaya] Length = 440 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/48 (77%), Positives = 38/48 (79%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|YP_006666108.1| CcmFC (mitochondrion) [Malus domestica] gi|401661914|emb|CBX33369.1| ccmFC (mitochondrion) [Malus domestica] Length = 436 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT +FPLLVY++SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPAFPLLVYIHSRKFIRSMDGAK 72 >dbj|BAO50895.1| cytochrome c biogenesis FC (mitochondrion) [Hevea brasiliensis] Length = 448 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVP GAPSSNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPIGAPSSNGTINPIPISSFPLLVYLHSRKFIRSMDGAK 72 >gb|AGC78967.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803259|gb|AGC78994.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 298 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTLIPILIPSFPLLVYLHSRKFIRSMDGAK 72 >gb|AGC78965.1| cytochrome c biogenesis FC (mitochondrion) [Vicia faba] gi|442803257|gb|AGC78992.1| cytochrome c biogenesis FC (mitochondrion) [Vicia faba] Length = 443 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTLIPILIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|YP_007516870.1| cytochrome c biogenesis FC (mitochondrion) [Glycine max] gi|403311561|gb|AFR34309.1| cytochrome c biogenesis FC (mitochondrion) [Glycine max] Length = 443 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPILIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPILIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|YP_004237254.1| cytochrome c biogenesis FC (mitochondrion) [Ricinus communis] gi|322394260|gb|ADW96017.1| cytochrome c biogenesis FC (mitochondrion) [Ricinus communis] Length = 439 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVP GAPSSNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPIGAPSSNGTIIPIPISSFPLLVYLHSRKFIRSMDGAK 72 >ref|YP_004222809.1| cytochrome c biogenesis FC [Vigna radiata] gi|308206738|gb|ADO19875.1| cytochrome c biogenesis FC [Vigna radiata] Length = 442 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPILIPSFPLLVYLHSRKFIRSMDGAK 72 >ref|XP_002534941.1| conserved hypothetical protein [Ricinus communis] gi|223524327|gb|EEF27442.1| conserved hypothetical protein [Ricinus communis] Length = 445 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVP GAPSSNGT SFPLLVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPIGAPSSNGTIIPIPISSFPLLVYLHSRKFIRSMDGAK 72 >gb|AGK25078.1| cytochrome c biogenesis FC, partial (mitochondrion) [Magnolia stellata] Length = 419 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT FP LVYL+SRKFI SMD K Sbjct: 11 LLKWFVSRDVPTGAPSSNGTIIPIPIPEFPFLVYLHSRKFIRSMDGAK 58 >ref|YP_007905719.1| cytochrome c biogenesis FC (mitochondrion) [Liriodendron tulipifera] gi|480541923|gb|AGJ90416.1| cytochrome c biogenesis FC (mitochondrion) [Liriodendron tulipifera] Length = 452 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT FP LVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPEFPFLVYLHSRKFIRSMDGAK 72 >ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081937|gb|AEY81129.1| cytochrome c biogenesis FC (mitochondrion) [Daucus carota subsp. sativus] Length = 450 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT SFPLLVYL+S+KFI S D K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTIIPIPIPSFPLLVYLHSKKFIRSTDGAK 72 >ref|YP_006280948.1| cytochrome c biogenesis FC (mitochondrion) [Spirodela polyrhiza] gi|385252650|gb|AFI54958.1| cytochrome c biogenesis FC (mitochondrion) [Spirodela polyrhiza] Length = 438 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAPSSNGT FP LVYL+SRKFI SMD K Sbjct: 25 LLKWFVSRDVPTGAPSSNGTLIPILIPEFPFLVYLHSRKFIHSMDRAK 72 >ref|XP_006396157.1| hypothetical protein EUTSA_v10002931mg [Eutrema salsugineum] gi|557096428|gb|ESQ36936.1| hypothetical protein EUTSA_v10002931mg [Eutrema salsugineum] Length = 357 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRK I SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPIPISSFPLLVYLHSRKIIRSMDGAK 72 >gb|AEX57643.1| CcmFC (mitochondrion) [Raphanus sativus] gi|443298159|gb|AGC81703.1| cytochrome c biogenesis FC (mitochondrion) [Raphanus sativus] Length = 452 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRK I SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPIPISSFPLLVYLHSRKIIRSMDGAK 72 >ref|YP_006665991.1| cytochrome c biogenesis protein ccmFC (mitochondrion) [Raphanus sativus] gi|400278310|dbj|BAM36233.1| cytochrome c biogenesis protein ccmFC (mitochondrion) [Raphanus sativus] Length = 442 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRK I SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPIPISSFPLLVYLHSRKIIRSMDGAK 72 >dbj|BAM36190.1| cytochrome c biogenesis protein ccmFC (mitochondrion) [Raphanus sativus] Length = 442 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = +3 Query: 105 LLKWFVSRDVPTGAPSSNGTXXXXXXXSFPLLVYLNSRKFICSMDDGK 248 LLKWFVSRDVPTGAP SNGT SFPLLVYL+SRK I SMD K Sbjct: 25 LLKWFVSRDVPTGAPFSNGTIIPIPISSFPLLVYLHSRKIIRSMDGAK 72