BLASTX nr result
ID: Paeonia23_contig00035101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00035101 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004292451.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 emb|CBI32451.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_007199262.1| hypothetical protein PRUPE_ppa022663mg [Prun... 71 1e-10 ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002313097.2| hypothetical protein POPTR_0009s10870g [Popu... 69 5e-10 ref|NP_198787.1| pentatricopeptide repeat-containing protein EMB... 69 9e-10 ref|XP_002870767.1| EMB2745 [Arabidopsis lyrata subsp. lyrata] g... 66 4e-09 ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 66 6e-09 ref|XP_004137116.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_007042371.1| Tetratricopeptide repeat (TPR)-like superfam... 65 7e-09 ref|XP_006282494.1| hypothetical protein CARUB_v10006484mg [Caps... 65 1e-08 ref|XP_006405601.1| hypothetical protein EUTSA_v10027654mg [Eutr... 64 2e-08 ref|XP_004498166.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_003556634.2| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_007201996.1| hypothetical protein PRUPE_ppa024918mg [Prun... 55 8e-06 >ref|XP_004292451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Fragaria vesca subsp. vesca] Length = 751 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/50 (76%), Positives = 40/50 (80%) Frame = +3 Query: 201 PSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 PS A LADKAIT LKRHP+ L S SS FTP AAS LL KSQFD+TLTLKF Sbjct: 18 PSDAALADKAITYLKRHPHNLHSLSSDFTPDAASCLLLKSQFDQTLTLKF 67 >ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Length = 762 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = +3 Query: 204 SGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 S A L DKAITLLK HP+ L S SS FTPQ+ASY L KSQFD+TLTLKF Sbjct: 29 SHALLVDKAITLLKFHPHHLDSLSSRFTPQSASYFLLKSQFDQTLTLKF 77 >emb|CBI32451.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = +3 Query: 204 SGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 S A L DKAITLLK HP+ L S SS FTPQ+ASY L KSQFD+TLTLKF Sbjct: 29 SHALLVDKAITLLKFHPHHLDSLSSRFTPQSASYFLLKSQFDQTLTLKF 77 >ref|XP_007199262.1| hypothetical protein PRUPE_ppa022663mg [Prunus persica] gi|462394662|gb|EMJ00461.1| hypothetical protein PRUPE_ppa022663mg [Prunus persica] Length = 558 Score = 71.2 bits (173), Expect = 1e-10 Identities = 41/76 (53%), Positives = 48/76 (63%) Frame = +3 Query: 123 MPRLKPYFKSIHAXXXXXXXXXXXXTPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAAS 302 MP LKP+ IH PS LA++AIT LKRHP+ L S SS FTP+AAS Sbjct: 1 MPLLKPH---IHKPSSFPG------APSDTLLAERAITYLKRHPHNLTSLSSGFTPEAAS 51 Query: 303 YLLFKSQFDRTLTLKF 350 +LL KSQFD+ LTLKF Sbjct: 52 FLLLKSQFDQPLTLKF 67 >ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Citrus sinensis] Length = 766 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 210 AFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 A LADKA+TLLKRHPYQL S SS FTP+AA LL K+Q D+TLTLKF Sbjct: 33 AVLADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKF 79 >ref|XP_002313097.2| hypothetical protein POPTR_0009s10870g [Populus trichocarpa] gi|550331476|gb|EEE87052.2| hypothetical protein POPTR_0009s10870g [Populus trichocarpa] Length = 751 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +3 Query: 198 TPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +P+ A LA+KA+TLLKR+PY L S SS TP+ ASYLL ++Q DRTLTLKF Sbjct: 17 SPTDALLAEKALTLLKRYPYHLNSISSQITPELASYLLLQTQNDRTLTLKF 67 >ref|NP_198787.1| pentatricopeptide repeat-containing protein EMB2745 [Arabidopsis thaliana] gi|75170916|sp|Q9FIX3.1|PP407_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39710; AltName: Full=Protein EMBRYO DEFECTIVE 2745 gi|10177971|dbj|BAB11377.1| unnamed protein product [Arabidopsis thaliana] gi|332007083|gb|AED94466.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 747 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +3 Query: 198 TPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +PS + LADKA+T LKRHPYQL S++FTP+AAS LL KSQ D+ L LKF Sbjct: 18 SPSDSLLADKALTFLKRHPYQLHHLSANFTPEAASNLLLKSQNDQALILKF 68 >ref|XP_002870767.1| EMB2745 [Arabidopsis lyrata subsp. lyrata] gi|297316603|gb|EFH47026.1| EMB2745 [Arabidopsis lyrata subsp. lyrata] Length = 747 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = +3 Query: 198 TPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +PS + LADKA+T LKRHPYQL S++FTP+AAS LL KSQ ++ L LKF Sbjct: 18 SPSDSLLADKALTFLKRHPYQLHHLSANFTPEAASNLLLKSQNNQELILKF 68 >ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Length = 749 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 210 AFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 A LADKAI L+RHP QL SSHFTPQA+S LL KSQFD +L LKF Sbjct: 21 ALLADKAIVYLRRHPEQLTLLSSHFTPQASSNLLLKSQFDSSLVLKF 67 >ref|XP_004137116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Length = 749 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +3 Query: 210 AFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 A LADKAI L+RHP QL SSHFTPQA+S LL KSQFD +L LKF Sbjct: 21 ALLADKAIVYLRRHPEQLTLLSSHFTPQASSNLLLKSQFDSSLVLKF 67 >ref|XP_007042371.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706306|gb|EOX98202.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 745 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +3 Query: 198 TPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +P+ A LA KA+T LKRHPY L S +S+FTP+AA LL KSQ D+TL LKF Sbjct: 17 SPADALLAGKALTFLKRHPYHLNSLTSNFTPEAAFCLLLKSQNDQTLILKF 67 >ref|XP_006282494.1| hypothetical protein CARUB_v10006484mg [Capsella rubella] gi|482551199|gb|EOA15392.1| hypothetical protein CARUB_v10006484mg [Capsella rubella] Length = 747 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +3 Query: 204 SGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 S + LADKA+T L+RHPYQL S++FTP+AAS LL KSQ D+ L LKF Sbjct: 19 SDSLLADKAVTFLRRHPYQLHHLSANFTPEAASNLLLKSQNDQELVLKF 67 >ref|XP_006405601.1| hypothetical protein EUTSA_v10027654mg [Eutrema salsugineum] gi|557106739|gb|ESQ47054.1| hypothetical protein EUTSA_v10027654mg [Eutrema salsugineum] Length = 747 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +3 Query: 198 TPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +PS + LADKA+T+L+RHPYQL S+ FTP AAS LL +SQ D+ L LKF Sbjct: 18 SPSDSLLADKALTILRRHPYQLPYLSADFTPDAASNLLLRSQNDQELILKF 68 >ref|XP_004498166.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Cicer arietinum] gi|502123561|ref|XP_004498167.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Cicer arietinum] Length = 749 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 216 LADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 +A+KAIT LKRHP L S HFTPQAA+YLL SQF++ LTLKF Sbjct: 10 MAEKAITYLKRHPQNLPSLIPHFTPQAATYLLLTSQFNKPLTLKF 54 >ref|XP_003556634.2| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Glycine max] gi|571563372|ref|XP_006605469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Glycine max] Length = 778 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 210 AFLADKAITLLKRHPYQLQSFSSHFTPQAASYLLFKSQFDRTLTLKF 350 + +ADKAI LKRHP +L S S HFTPQAASY+L SQ D+ L F Sbjct: 34 SLIADKAIAFLKRHPQRLASLSPHFTPQAASYVLLNSQSDQRTLLNF 80 >ref|XP_007201996.1| hypothetical protein PRUPE_ppa024918mg [Prunus persica] gi|462397527|gb|EMJ03195.1| hypothetical protein PRUPE_ppa024918mg [Prunus persica] Length = 618 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/67 (47%), Positives = 38/67 (56%) Frame = +3 Query: 123 MPRLKPYFKSIHAXXXXXXXXXXXXTPSGAFLADKAITLLKRHPYQLQSFSSHFTPQAAS 302 MP LKP+ + PS LA+KAIT LKRHP+ L S SS FTP+AAS Sbjct: 1 MPLLKPHIPKPSSFAC---------APSDTLLAEKAITYLKRHPHNLNSLSSCFTPEAAS 51 Query: 303 YLLFKSQ 323 YLL +Q Sbjct: 52 YLLQNAQ 58