BLASTX nr result
ID: Paeonia23_contig00034726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00034726 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 82 1e-13 gb|AGC78966.1| hypothetical protein (mitochondrion) [Vicia faba]... 57 3e-06 ref|XP_002489008.1| hypothetical protein SORBIDRAFT_0506s002170 ... 55 8e-06 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/60 (66%), Positives = 43/60 (71%) Frame = +3 Query: 75 GEREALAL*GRFWGDKLVKKQAYPRPDRQLLDLPISPKLPPVVGPSCMRRKLVPHTVRRP 254 G+ + A FWG QAYPRPDRQLL LPISPKLPPV GPSCMR+KL P TVRRP Sbjct: 391 GDSDRGAYINGFWGG-FASSQAYPRPDRQLLGLPISPKLPPVFGPSCMRQKLAPRTVRRP 449 >gb|AGC78966.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803258|gb|AGC78993.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 227 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 162 LLDLPISPKLPPVVGPSCMRRKLVPHTVRRP 254 +L LPISPKLPPV GPSCMR+KL P TVRRP Sbjct: 1 MLGLPISPKLPPVFGPSCMRQKLAPRTVRRP 31 >ref|XP_002489008.1| hypothetical protein SORBIDRAFT_0506s002170 [Sorghum bicolor] gi|241947355|gb|EES20500.1| hypothetical protein SORBIDRAFT_0506s002170 [Sorghum bicolor] Length = 67 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/57 (52%), Positives = 32/57 (56%), Gaps = 9/57 (15%) Frame = +3 Query: 111 WGDKLVKKQAYPRPDRQLLDLPISP---------KLPPVVGPSCMRRKLVPHTVRRP 254 WG+KL QAYPRP L P P PV GPSCMR+KLVP TVRRP Sbjct: 2 WGNKLASSQAYPRP----LSCPSRPAAVGSPHLSSTSPVFGPSCMRQKLVPRTVRRP 54