BLASTX nr result
ID: Paeonia23_contig00034606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00034606 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 100 3e-19 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 100 3e-19 emb|CBI20053.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002269015.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 emb|CAN60904.1| hypothetical protein VITISV_016343 [Vitis vinifera] 92 7e-17 gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis] 91 2e-16 ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Caps... 89 6e-16 ref|NP_179165.1| pentatricopeptide repeat-containing protein [Ar... 89 6e-16 ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_004137128.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_002519129.1| pentatricopeptide repeat-containing protein,... 86 5e-15 ref|XP_004168722.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-15 ref|XP_006409538.1| hypothetical protein EUTSA_v10022592mg [Eutr... 85 1e-14 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 ref|XP_002883912.1| pentatricopeptide repeat-containing protein ... 82 8e-14 ref|XP_006379222.1| hypothetical protein POPTR_0009s11220g, part... 81 1e-13 ref|XP_004292464.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 gb|EYU42646.1| hypothetical protein MIMGU_mgv1a019227mg [Mimulus... 80 3e-13 ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, part... 79 8e-13 ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citr... 74 2e-11 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 100 bits (248), Expect = 3e-19 Identities = 58/139 (41%), Positives = 79/139 (56%) Frame = +3 Query: 6 HNMKIPKHKAVGLQTFKQKKLSTLFKTKHXXXXXXXXXXXXXKVSPEMPKAPTYNTPITE 185 +NMK HK + Q K+KKL T+ + + T ++ I+ Sbjct: 14 NNMKA--HKVLSSQILKRKKLKTVIPHSSALCSSTSQLVTSDQ-------SQTASSQISP 64 Query: 186 RFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIENYCL 365 + +SV SSQWH IKH S+ ++PS+IS L NLHKTP+LAL+F IE RLD++ CL Sbjct: 65 ELLIESVRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVKTRCL 124 Query: 366 ATVIISCLPSPKPALELLK 422 A + S LPSPKP L+LLK Sbjct: 125 AIAVASRLPSPKPTLQLLK 143 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 100 bits (248), Expect = 3e-19 Identities = 58/139 (41%), Positives = 79/139 (56%) Frame = +3 Query: 6 HNMKIPKHKAVGLQTFKQKKLSTLFKTKHXXXXXXXXXXXXXKVSPEMPKAPTYNTPITE 185 +NMK HK + Q K+KKL T+ + + T ++ I+ Sbjct: 14 NNMKA--HKVLSSQILKRKKLKTVIPHSSALCSSTSQLVTSDQ-------SQTASSQISP 64 Query: 186 RFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIENYCL 365 + +SV SSQWH IKH S+ ++PS+IS L NLHKTP+LAL+F IE RLD++ CL Sbjct: 65 ELLIESVRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVKTRCL 124 Query: 366 ATVIISCLPSPKPALELLK 422 A + S LPSPKP L+LLK Sbjct: 125 AIAVASRLPSPKPTLQLLK 143 >emb|CBI20053.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/83 (55%), Positives = 58/83 (69%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PITE I SVLSSQWH I+ VS + P+LISN L+NL P L FI+ + H LD + Sbjct: 46 PITEEVISKSVLSSQWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTK 105 Query: 354 NYCLATVIISCLPSPKPALELLK 422 +YCLA V+++ LPSPK AL+LLK Sbjct: 106 SYCLAVVLLARLPSPKLALQLLK 128 >ref|XP_002269015.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Vitis vinifera] Length = 656 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/83 (55%), Positives = 58/83 (69%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PITE I SVLSSQWH I+ VS + P+LISN L+NL P L FI+ + H LD + Sbjct: 68 PITEEVISKSVLSSQWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTK 127 Query: 354 NYCLATVIISCLPSPKPALELLK 422 +YCLA V+++ LPSPK AL+LLK Sbjct: 128 SYCLAVVLLARLPSPKLALQLLK 150 >emb|CAN60904.1| hypothetical protein VITISV_016343 [Vitis vinifera] Length = 580 Score = 92.0 bits (227), Expect = 7e-17 Identities = 45/83 (54%), Positives = 58/83 (69%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PIT+ I SVLSSQWH I+ VS + P+LISN L+NL P L FI+ + H LD + Sbjct: 68 PITZEVISKSVLSSQWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTK 127 Query: 354 NYCLATVIISCLPSPKPALELLK 422 +YCLA V+++ LPSPK AL+LLK Sbjct: 128 SYCLAVVLLARLPSPKLALQLLK 150 >gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis] Length = 634 Score = 90.9 bits (224), Expect = 2e-16 Identities = 49/97 (50%), Positives = 64/97 (65%), Gaps = 3/97 (3%) Frame = +3 Query: 141 PEMPKAPTYNTP---ITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLAL 311 P+ K P + P IT++ + + SSQWH IK S + SLIS+TL LH+TP L L Sbjct: 32 PQQTKNPEKHNPQDIITQKSLLKLIHSSQWHFIKQHSRNLSTSLISDTLCTLHQTPQLVL 91 Query: 312 KFIYQIESHRLDIENYCLATVIISCLPSPKPALELLK 422 KFI QIE RL++E+ CLAT I++ +PSPK AL LLK Sbjct: 92 KFINQIEFDRLNVESLCLATTILAPIPSPKTALHLLK 128 >ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] gi|482565923|gb|EOA30112.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] Length = 623 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/83 (51%), Positives = 56/83 (67%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PIT + DS+ SSQWH+++H+S PSL+S TL NL KTPDLAL F+ I+ LD + Sbjct: 40 PITSDILLDSIKSSQWHIVEHLSDKFTPSLLSTTLLNLVKTPDLALGFVNHIDLRCLDFQ 99 Query: 354 NYCLATVIISCLPSPKPALELLK 422 CLA ++S L SPKP +LLK Sbjct: 100 TQCLAIAVVSKLSSPKPVTQLLK 122 >ref|NP_179165.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216226|sp|Q9ZQF1.1|PP152_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15630, mitochondrial; Flags: Precursor gi|4335729|gb|AAD17407.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330251331|gb|AEC06425.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 627 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/83 (49%), Positives = 58/83 (69%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PIT + +S+ SSQWH+++HV+ + PSL+S TL +L KTP+LA F+ I+ +RLD + Sbjct: 44 PITSEILLESIRSSQWHIVEHVADKLTPSLVSTTLLSLVKTPNLAFNFVNHIDLYRLDFQ 103 Query: 354 NYCLATVIISCLPSPKPALELLK 422 CLA +IS L SPKP +LLK Sbjct: 104 TQCLAIAVISKLSSPKPVTQLLK 126 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 86.7 bits (213), Expect = 3e-15 Identities = 45/92 (48%), Positives = 59/92 (64%) Frame = +3 Query: 147 MPKAPTYNTPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQ 326 + K+ + PIT + +SV SSQWH IKHV+ ++P+LIS TL +L +PD L FI Sbjct: 20 LSKSTSPTIPITAEVLRESVTSSQWHFIKHVTGELNPTLISATLPDLRSSPDRVLTFIEN 79 Query: 327 IESHRLDIENYCLATVIISCLPSPKPALELLK 422 + + LDI YCLA I+S LPSPK A LLK Sbjct: 80 LSPNCLDISCYCLAISILSRLPSPKQATHLLK 111 >ref|XP_004137128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Length = 628 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/84 (50%), Positives = 53/84 (63%) Frame = +3 Query: 171 TPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDI 350 +P+T F+ S SSQWH IK V + + PSLIS TL NLH++P + L F+ D Sbjct: 38 SPLTPHFLEQSARSSQWHFIKQVESSLTPSLISQTLLNLHESPQVVLDFLNHFHHKLSDA 97 Query: 351 ENYCLATVIISCLPSPKPALELLK 422 CLA VI++ LPSPKPAL LLK Sbjct: 98 RTLCLAIVIVARLPSPKPALHLLK 121 >ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541792|gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 643 Score = 85.9 bits (211), Expect = 5e-15 Identities = 44/82 (53%), Positives = 56/82 (68%) Frame = +3 Query: 177 ITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIEN 356 IT + + DS+ SSQWHLIKH++ + PSLIS TL +LHK DLAL+F+ I LDI+ Sbjct: 56 ITHQSLLDSIQSSQWHLIKHLAPNLSPSLISATLLSLHKKSDLALQFVTHIGFKGLDIKT 115 Query: 357 YCLATVIISCLPSPKPALELLK 422 CLA ++S PSPK L LLK Sbjct: 116 KCLAVAVVSRSPSPKSTLHLLK 137 >ref|XP_004168722.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Length = 628 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/84 (48%), Positives = 53/84 (63%) Frame = +3 Query: 171 TPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDI 350 +P+T F+ S SSQWH IK V + + PSLIS TL NLH++P + L F+ D Sbjct: 38 SPLTPHFLEQSARSSQWHFIKQVESSLTPSLISQTLLNLHESPQVVLDFLNHFHHKLSDA 97 Query: 351 ENYCLATVIISCLPSPKPALELLK 422 CLA VI++ LPSPKPAL LL+ Sbjct: 98 RTLCLAIVIVARLPSPKPALHLLR 121 >ref|XP_006409538.1| hypothetical protein EUTSA_v10022592mg [Eutrema salsugineum] gi|557110700|gb|ESQ50991.1| hypothetical protein EUTSA_v10022592mg [Eutrema salsugineum] Length = 633 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/82 (51%), Positives = 55/82 (67%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PI+ + +SV SSQWH ++ +S I PS++S TL NL KTPDLAL F+ I+ LD Sbjct: 45 PISSDILLESVRSSQWHFVEQLSDKITPSVVSTTLLNLVKTPDLALSFVKHIDLRFLDFS 104 Query: 354 NYCLATVIISCLPSPKPALELL 419 CLA ++S L SPKPAL+LL Sbjct: 105 TQCLAIAVVSKLSSPKPALQLL 126 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum lycopersicum] Length = 618 Score = 84.7 bits (208), Expect = 1e-14 Identities = 45/92 (48%), Positives = 57/92 (61%) Frame = +3 Query: 147 MPKAPTYNTPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQ 326 + K+ + PIT + +SV SSQWH IKHV+ ++P+LIS TL L +PD L FI Sbjct: 20 LSKSTSPTIPITAEVLRESVTSSQWHFIKHVTGELNPTLISATLPELRSSPDRVLTFIEN 79 Query: 327 IESHRLDIENYCLATVIISCLPSPKPALELLK 422 + LDI YCLA I+S LPSPK A LLK Sbjct: 80 LGPDCLDISCYCLAISILSRLPSPKQATHLLK 111 >ref|XP_002883912.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329752|gb|EFH60171.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/83 (48%), Positives = 54/83 (65%) Frame = +3 Query: 174 PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIE 353 PIT + +S+ SSQWH I+HV+ + PSL+S TL +L KTPDLA F+ I+ LD + Sbjct: 45 PITSEVLLESIKSSQWHFIEHVTDKLIPSLVSTTLLSLVKTPDLAFNFVNHIDLRCLDFQ 104 Query: 354 NYCLATVIISCLPSPKPALELLK 422 CLA ++S L SPK +LLK Sbjct: 105 TQCLAIAVVSKLSSPKSVTQLLK 127 >ref|XP_006379222.1| hypothetical protein POPTR_0009s11220g, partial [Populus trichocarpa] gi|550331503|gb|ERP57019.1| hypothetical protein POPTR_0009s11220g, partial [Populus trichocarpa] Length = 451 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 2/96 (2%) Frame = +3 Query: 141 PEMPKAPTYNT--PITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALK 314 P +P + + ++ P++ + I +S+ SSQWH +KH + I PSLIS T+ NLHKTPDL+ + Sbjct: 1 PTIPNSVSKHSQRPLSPQKILNSMHSSQWHFVKHFAPKITPSLISTTIINLHKTPDLSFQ 60 Query: 315 FIYQIESHRLDIENYCLATVIISCLPSPKPALELLK 422 F+ I + +DI + LA S P+PKP L+LLK Sbjct: 61 FVIHIGFNGVDIRSRYLAMAATSHAPNPKPTLQLLK 96 >ref|XP_004292464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 623 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/91 (41%), Positives = 55/91 (60%) Frame = +3 Query: 150 PKAPTYNTPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQI 329 P P PIT + +S+ +S WH I+H+ + SL+S TL +LH+TP L +F Sbjct: 27 PSPPPPPPPITHLSLLNSIQTSHWHFIQHLPPNLPSSLVSQTLFSLHQTPHLVHRFTSHF 86 Query: 330 ESHRLDIENYCLATVIISCLPSPKPALELLK 422 + RLD + CLA I++ LPSPKP++ LLK Sbjct: 87 DLRRLDTDTQCLAAAILAALPSPKPSIALLK 117 >gb|EYU42646.1| hypothetical protein MIMGU_mgv1a019227mg [Mimulus guttatus] Length = 534 Score = 80.1 bits (196), Expect = 3e-13 Identities = 43/94 (45%), Positives = 57/94 (60%) Frame = +3 Query: 141 PEMPKAPTYNTPITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFI 320 P P P ++ + +V SS WHLIKH+S P+LIS+TL +L ++P LAL FI Sbjct: 35 PPPPPPPPPRISVSPETLVSTVESSNWHLIKHLSPNFTPALISSTLLHLRRSPLLALSFI 94 Query: 321 YQIESHRLDIENYCLATVIISCLPSPKPALELLK 422 I+ L E YCLA I + LPSP+ AL+LLK Sbjct: 95 ENIDRSSLTTECYCLAVAIAALLPSPRHALKLLK 128 >ref|XP_007201524.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] gi|462396924|gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] Length = 545 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/68 (54%), Positives = 47/68 (69%) Frame = +3 Query: 219 WHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIYQIESHRLDIENYCLATVIISCLPSP 398 WH IKH+S + PSLIS L L K+P L L+FI ++ HRLDI+ CLA I++ SP Sbjct: 1 WHFIKHLSPNLSPSLISEALFELQKSPQLVLEFISNVDFHRLDIQTRCLAIAIVARQSSP 60 Query: 399 KPALELLK 422 +PALELLK Sbjct: 61 QPALELLK 68 >ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] gi|568851376|ref|XP_006479369.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Citrus sinensis] gi|557525069|gb|ESR36375.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] Length = 645 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/94 (43%), Positives = 57/94 (60%), Gaps = 2/94 (2%) Frame = +3 Query: 147 MPKAPTYNTP-ITERFIHDSVLSSQWHLIKHVSTIIDPSLISNTLHNLHKTPDLALKFIY 323 +P N P IT ++ + SSQWH IK ++ I PSLI++ L +LHK PDLA +FI Sbjct: 46 IPNTSGGNLPEITSELLNSYIHSSQWHFIKQLAPKITPSLITSALLDLHKNPDLAFQFIN 105 Query: 324 QIESHRL-DIENYCLATVIISCLPSPKPALELLK 422 + R+ DI+ C A +IS L + KP L+LLK Sbjct: 106 HLGFRRIRDIKTRCFAIAVISRLSTSKPTLQLLK 139