BLASTX nr result
ID: Paeonia23_contig00034456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00034456 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428864.1| hypothetical protein CICLE_v10013881mg, part... 56 5e-06 >ref|XP_006428864.1| hypothetical protein CICLE_v10013881mg, partial [Citrus clementina] gi|557530921|gb|ESR42104.1| hypothetical protein CICLE_v10013881mg, partial [Citrus clementina] Length = 666 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/76 (38%), Positives = 40/76 (52%) Frame = +3 Query: 3 IFAVDMHSGRRVESIHSXXXXXXXXRNTLLEFHVRFDTGLRAQRFSELRVNFKDKDTVPT 182 +F+ M S +R ES H +N+LL+F +RF+ L QR EL N D + PT Sbjct: 361 VFSAGMSSSQRAESYHFFFKRYVSKKNSLLDFMIRFNRALNHQRHEELNANHADINEKPT 420 Query: 183 LKTSFAIERVMTSRYT 230 LK +E+ M S YT Sbjct: 421 LKLPLKMEKQMVSLYT 436