BLASTX nr result
ID: Paeonia23_contig00034097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00034097 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359377.1| PREDICTED: phytochrome A-associated F-box pr... 57 2e-06 ref|XP_004247422.1| PREDICTED: phytochrome A-associated F-box pr... 57 2e-06 ref|XP_007201540.1| hypothetical protein PRUPE_ppa017065mg, part... 57 3e-06 emb|CBI36850.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002266159.1| PREDICTED: phytochrome A-associated F-box pr... 57 3e-06 ref|XP_002523077.1| Phytochrome A-associated F-box protein, puta... 57 3e-06 emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] 57 3e-06 ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box pr... 57 4e-06 gb|AFK45289.1| unknown [Medicago truncatula] 57 4e-06 ref|XP_006479952.1| PREDICTED: phytochrome A-associated F-box pr... 56 6e-06 ref|XP_006444317.1| hypothetical protein CICLE_v10021114mg [Citr... 56 6e-06 >ref|XP_006359377.1| PREDICTED: phytochrome A-associated F-box protein-like [Solanum tuberosum] Length = 332 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI L C +T DLHSAFCLRR+F YHD+ P+V+AY+C Sbjct: 272 NRKKIDLNCAFCSAKQTWDLHSAFCLRRYFGYHDDGEPVVRAYVC 316 >ref|XP_004247422.1| PREDICTED: phytochrome A-associated F-box protein-like [Solanum lycopersicum] Length = 325 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 5/58 (8%) Frame = +3 Query: 132 SFSNILIWNQI-----KIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 +F +W I KI L C +T DLHSAFCLRR+F YHD+ P+V+AY+C Sbjct: 252 NFKQSRVWRTINDGNRKIDLNCAFCSSKQTWDLHSAFCLRRYFGYHDDGEPVVRAYVC 309 >ref|XP_007201540.1| hypothetical protein PRUPE_ppa017065mg, partial [Prunus persica] gi|462396940|gb|EMJ02739.1| hypothetical protein PRUPE_ppa017065mg, partial [Prunus persica] Length = 321 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI L C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 261 NRSKIDLNCAFCSCKETWDLHSAFCLRRVFGYHDDGEPVVRAYVC 305 >emb|CBI36850.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ K+ L C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 224 NRSKVDLNCAFCPCKETWDLHSAFCLRRGFGYHDDGEPVVRAYVC 268 >ref|XP_002266159.1| PREDICTED: phytochrome A-associated F-box protein-like [Vitis vinifera] Length = 330 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ K+ L C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 270 NRSKVDLNCAFCPCKETWDLHSAFCLRRGFGYHDDGEPVVRAYVC 314 >ref|XP_002523077.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] gi|223537639|gb|EEF39262.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] Length = 332 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI L C ET DLHSAFCLRR F YHD+ PIV+AY+C Sbjct: 272 NRRKIDLNCAFCGCKETWDLHSAFCLRRVFGYHDDGEPIVRAYVC 316 >emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] Length = 720 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ K+ L C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 660 NRSKVDLNCAFCPCKETWDLHSAFCLRRGFGYHDDGEPVVRAYVC 704 >ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box protein-like [Cucumis sativus] Length = 379 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI L C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 319 NRNKIDLNCAFCSCKETWDLHSAFCLRRVFGYHDDGEPVVRAYVC 363 >gb|AFK45289.1| unknown [Medicago truncatula] Length = 304 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +3 Query: 150 IWNQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 I N+ KI L V C T DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 242 ISNRKKIDLACVFCSCNHTWDLHSAFCLRRGFGYHDDGEPVVRAYVC 288 >ref|XP_006479952.1| PREDICTED: phytochrome A-associated F-box protein-like [Citrus sinensis] Length = 326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI + C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 266 NRSKIDVNCAFCNCKETWDLHSAFCLRRVFGYHDDGEPVVRAYVC 310 >ref|XP_006444317.1| hypothetical protein CICLE_v10021114mg [Citrus clementina] gi|557546579|gb|ESR57557.1| hypothetical protein CICLE_v10021114mg [Citrus clementina] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 156 NQIKIYLKYVLC*F*ET*DLHSAFCLRRHFNYHDNSNPIVQAYIC 290 N+ KI + C ET DLHSAFCLRR F YHD+ P+V+AY+C Sbjct: 268 NRSKIDVNCAFCNCKETWDLHSAFCLRRVFGYHDDGEPVVRAYVC 312