BLASTX nr result
ID: Paeonia23_contig00033497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033497 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007008861.1| Cysteine/Histidine-rich C1 domain family pro... 57 4e-06 ref|XP_006468700.1| PREDICTED: uncharacterized protein LOC102618... 55 8e-06 >ref|XP_007008861.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508725774|gb|EOY17671.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 733 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = -3 Query: 202 EIHQARRCSNSCGSVCDTSVFRCVECDYNVHKLCAEWPKQIRHPFHKIHSIT-LKNEPYS 26 E + CS CG + F CVEC + + K CAE P Q+ HPFH+ HS+ L + PY Sbjct: 22 ESEEQAYCSG-CGKLVSGPSFSCVECGFYLDKKCAEAPSQLNHPFHRNHSLNLLASSPYD 80 Query: 25 SSIS 14 +S+S Sbjct: 81 ASLS 84 >ref|XP_006468700.1| PREDICTED: uncharacterized protein LOC102618382 [Citrus sinensis] Length = 1272 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -3 Query: 184 RCSNSCGSVCDT-SVFRCVECDYNVHKLCAEWPKQIRHPFHKIHSITLKNEPYS 26 +C C S+ + S + C C++ +HK C+E P+Q+RHPFH HS+TL+N S Sbjct: 179 KCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLS 232