BLASTX nr result
ID: Paeonia23_contig00033410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033410 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003844504.1| hypothetical protein LEMA_P021550.1 [Leptosp... 65 1e-08 gb|EON66561.1| 60S ribosomal protein L33-B [Coniosporium apollin... 65 1e-08 ref|XP_007290451.1| 60S ribosomal protein L33 [Marssonina brunne... 64 3e-08 ref|XP_001799711.1| hypothetical protein SNOG_09417 [Phaeosphaer... 64 3e-08 gb|ESZ98900.1| 60S ribosomal protein L33 [Sclerotinia borealis F... 63 4e-08 gb|EFW14318.1| 60S ribosomal protein L33 [Coccidioides posadasii... 63 4e-08 ref|XP_003068012.1| 60S ribosomal protein L33 [Coccidioides posa... 63 4e-08 ref|XP_001240474.1| 60S ribosomal protein L33 [Coccidioides immi... 63 4e-08 ref|XP_001931342.1| 60S ribosomal protein L33 [Pyrenophora triti... 63 5e-08 gb|EXJ74105.1| 60S ribosomal protein L33-B [Cladophialophora psa... 62 6e-08 gb|ETI26313.1| 60S ribosomal protein L33-A [Cladophialophora car... 62 6e-08 ref|XP_002582873.1| 60S ribosomal protein L33-A [Uncinocarpus re... 62 6e-08 ref|XP_002796789.1| 60S ribosomal protein L33 [Paracoccidioides ... 62 8e-08 gb|EZF20544.1| 60S ribosomal protein L33-A [Trichophyton rubrum ... 62 1e-07 gb|EPQ62532.1| Ribosomal protein L37 of the large (60S) ribosoma... 62 1e-07 gb|EPE29676.1| Translation protein [Glarea lozoyensis ATCC 20868] 62 1e-07 gb|ELR05072.1| hypothetical protein GMDG_01642 [Pseudogymnoascus... 62 1e-07 gb|EGE03723.1| 60S ribosomal protein L35a [Trichophyton equinum ... 62 1e-07 gb|EGD99236.1| 60S ribosomal protein L35a [Trichophyton tonsuran... 62 1e-07 ref|XP_003235916.1| 60S ribosomal protein L33 [Trichophyton rubr... 62 1e-07 >ref|XP_003844504.1| hypothetical protein LEMA_P021550.1 [Leptosphaeria maculans JN3] gi|312221084|emb|CBY01025.1| hypothetical protein LEMA_P021550.1 [Leptosphaeria maculans JN3] Length = 186 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 155 GNSGVVRAKFRSNLPPKSFGASVRVMLYPSSI 186 >gb|EON66561.1| 60S ribosomal protein L33-B [Coniosporium apollinis CBS 100218] Length = 109 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FRSNLPPKTFGASVR+MLYPSSI Sbjct: 78 GNSGVVRAQFRSNLPPKTFGASVRIMLYPSSI 109 >ref|XP_007290451.1| 60S ribosomal protein L33 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866285|gb|EKD19325.1| 60S ribosomal protein L33 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 109 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRAKFR+NLPPK+FGASVR+MLYPSSI Sbjct: 78 GNSGVVRAKFRNNLPPKSFGASVRIMLYPSSI 109 >ref|XP_001799711.1| hypothetical protein SNOG_09417 [Phaeosphaeria nodorum SN15] gi|111062489|gb|EAT83609.1| hypothetical protein SNOG_09417 [Phaeosphaeria nodorum SN15] Length = 108 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSG VRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 77 GNSGAVRAKFRSNLPPKSFGASVRVMLYPSSI 108 >gb|ESZ98900.1| 60S ribosomal protein L33 [Sclerotinia borealis F-4157] Length = 109 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPKTFGASVR+MLYPSS+ Sbjct: 78 GNSGVVRARFRQNLPPKTFGASVRIMLYPSSV 109 >gb|EFW14318.1| 60S ribosomal protein L33 [Coccidioides posadasii str. Silveira] gi|392867564|gb|EAS29195.2| 60S ribosomal protein L33-A [Coccidioides immitis RS] Length = 109 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 109 >ref|XP_003068012.1| 60S ribosomal protein L33 [Coccidioides posadasii C735 delta SOWgp] gi|240107688|gb|EER25867.1| 60S ribosomal protein L33-B, putative [Coccidioides posadasii C735 delta SOWgp] Length = 107 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 76 GNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 107 >ref|XP_001240474.1| 60S ribosomal protein L33 [Coccidioides immitis RS] Length = 104 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 73 GNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 104 >ref|XP_001931342.1| 60S ribosomal protein L33 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330944247|ref|XP_003306337.1| 60S ribosomal protein L33 [Pyrenophora teres f. teres 0-1] gi|187972948|gb|EDU40447.1| 60S ribosomal protein L33 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316187|gb|EFQ85570.1| hypothetical protein PTT_19467 [Pyrenophora teres f. teres 0-1] Length = 109 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRAKF++NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAKFKNNLPPKSFGASVRVMLYPSSI 109 >gb|EXJ74105.1| 60S ribosomal protein L33-B [Cladophialophora psammophila CBS 110553] Length = 109 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSG+VRAKFR NLPPK+FGASVR+MLYPSSI Sbjct: 78 GNSGIVRAKFRHNLPPKSFGASVRIMLYPSSI 109 >gb|ETI26313.1| 60S ribosomal protein L33-A [Cladophialophora carrionii CBS 160.54] gi|589973355|gb|EXJ56673.1| 60S ribosomal protein L33-B [Cladophialophora yegresii CBS 114405] Length = 110 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSG+VRAKFR NLPPK+FGASVR+MLYPSSI Sbjct: 79 GNSGIVRAKFRHNLPPKSFGASVRIMLYPSSI 110 >ref|XP_002582873.1| 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] gi|237908380|gb|EEP82781.1| 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] Length = 109 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR+NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRNNLPPKSFGASVRVMLYPSSI 109 >ref|XP_002796789.1| 60S ribosomal protein L33 [Paracoccidioides sp. 'lutzii' Pb01] gi|225680968|gb|EEH19252.1| 60S ribosomal protein L33-A [Paracoccidioides brasiliensis Pb03] gi|226282161|gb|EEH37727.1| 60S ribosomal protein L33-B [Paracoccidioides sp. 'lutzii' Pb01] Length = 109 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPKTFGA+VRVMLYPSSI Sbjct: 78 GNSGVVRAQFRHNLPPKTFGATVRVMLYPSSI 109 >gb|EZF20544.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR850] gi|607903355|gb|EZF40848.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 100081] gi|607915730|gb|EZF51756.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 288.86] gi|607927575|gb|EZF62164.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 289.86] gi|607939723|gb|EZF73002.1| 60S ribosomal protein L33-A [Trichophyton soudanense CBS 452.61] gi|607951484|gb|EZF83412.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR1448] gi|607963909|gb|EZF94366.1| 60S ribosomal protein L33-A [Trichophyton rubrum MR1459] gi|607976132|gb|EZG05343.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 735.88] gi|607987614|gb|EZG15641.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 202.88] Length = 109 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >gb|EPQ62532.1| Ribosomal protein L37 of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528298629|emb|CCU76235.1| 60S ribosomal protein L33 [Blumeria graminis f. sp. hordei DH14] Length = 109 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRRNLPPKSFGASVRVMLYPSSI 109 >gb|EPE29676.1| Translation protein [Glarea lozoyensis ATCC 20868] Length = 109 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRRNLPPKSFGASVRVMLYPSSI 109 >gb|ELR05072.1| hypothetical protein GMDG_01642 [Pseudogymnoascus destructans 20631-21] Length = 159 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 128 GNSGVVRAQFRRNLPPKSFGASVRVMLYPSSI 159 >gb|EGE03723.1| 60S ribosomal protein L35a [Trichophyton equinum CBS 127.97] gi|607896056|gb|EZF34635.1| 60S ribosomal protein L33-A [Trichophyton interdigitale H6] Length = 109 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 78 GNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >gb|EGD99236.1| 60S ribosomal protein L35a [Trichophyton tonsurans CBS 112818] Length = 110 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 79 GNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 110 >ref|XP_003235916.1| 60S ribosomal protein L33 [Trichophyton rubrum CBS 118892] gi|326461258|gb|EGD86711.1| 60S ribosomal protein L33-A [Trichophyton rubrum CBS 118892] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 254 GNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 159 GNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 93 GNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 124