BLASTX nr result
ID: Paeonia23_contig00033211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033211 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214636.1| hypothetical protein PRUPE_ppa001558mg [Prun... 47 6e-06 >ref|XP_007214636.1| hypothetical protein PRUPE_ppa001558mg [Prunus persica] gi|462410501|gb|EMJ15835.1| hypothetical protein PRUPE_ppa001558mg [Prunus persica] Length = 802 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 8/64 (12%) Frame = -3 Query: 245 ARMSKIPQTESCD--------TMYRMPSSSTNTDIDHIESSENRFKFKISKDNKEPKVDN 90 +R+ KIP+TES D ++YRMPS+S + +D SENR + + SKD ++ + +N Sbjct: 49 SRLPKIPRTESRDLDRRSPIHSIYRMPSTSNDLHVDQAAPSENRLESRDSKDTRDLRFEN 108 Query: 89 RYKK 78 R K Sbjct: 109 RDTK 112 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = -2 Query: 81 ESKLRDLYG*ANRDSKNDKSENNMKYE 1 +++ RDLY + RD++N K E +++Y+ Sbjct: 112 KTETRDLYSESRRDTQNAKGEKDVRYD 138