BLASTX nr result
ID: Paeonia23_contig00033082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00033082 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213669.1| hypothetical protein PRUPE_ppa001022mg [Prun... 63 5e-08 ref|XP_007038696.1| Disease resistance family protein / LRR fami... 62 1e-07 ref|XP_007038695.1| Disease resistance family protein / LRR fami... 61 2e-07 >ref|XP_007213669.1| hypothetical protein PRUPE_ppa001022mg [Prunus persica] gi|462409534|gb|EMJ14868.1| hypothetical protein PRUPE_ppa001022mg [Prunus persica] Length = 932 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 231 NQLVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQKQDT 106 N L I++KSNW PPFQL+++ MES K GTQ PQWLLTQK T Sbjct: 446 NHLTIRVKSNWEPPFQLKHVRMESCKFGTQFPQWLLTQKTIT 487 >ref|XP_007038696.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508775941|gb|EOY23197.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 966 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 231 NQLVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQ 118 N L I +KSNW+PPFQLEYI MES K GT+ PQWL TQ Sbjct: 443 NSLTITIKSNWVPPFQLEYIEMESCKFGTEFPQWLQTQ 480 >ref|XP_007038695.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] gi|508775940|gb|EOY23196.1| Disease resistance family protein / LRR family protein, putative [Theobroma cacao] Length = 966 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 231 NQLVIKLKSNWLPPFQLEYIHMES*KTGTQLPQWLLTQKQDTEL 100 N L IK+KSNW+PPFQLE I M S K GTQ PQWL TQ + T L Sbjct: 444 NSLTIKIKSNWVPPFQLECIEMGSCKFGTQFPQWLRTQLKATTL 487