BLASTX nr result
ID: Paeonia23_contig00032958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032958 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203971.1| hypothetical protein PRUPE_ppa024258mg [Prun... 59 9e-07 ref|XP_007218903.1| hypothetical protein PRUPE_ppa000524mg [Prun... 55 1e-05 >ref|XP_007203971.1| hypothetical protein PRUPE_ppa024258mg [Prunus persica] gi|462399502|gb|EMJ05170.1| hypothetical protein PRUPE_ppa024258mg [Prunus persica] Length = 1076 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +3 Query: 123 IFQGASEIPNWYSHQSKGDRVSFTVPQLDNCDITGIIFCAVY-DGGWTQNQWCELVPHIL 299 IF G +E+P +SH+S+G +SFTVP LDN G+IF VY + G+ C +PHI Sbjct: 883 IFFGGNEVPGQFSHKSRGSSISFTVPLLDNHRTRGLIFFVVYSNAGYDIQHNC--LPHIR 940 Query: 300 FKNESK 317 KN+SK Sbjct: 941 VKNKSK 946 >ref|XP_007218903.1| hypothetical protein PRUPE_ppa000524mg [Prunus persica] gi|462415365|gb|EMJ20102.1| hypothetical protein PRUPE_ppa000524mg [Prunus persica] Length = 1115 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = +3 Query: 126 FQGASEIPNWYSHQSKGDRVSFTVPQLDNCDITGIIFCAVYDGGWTQNQWCE--LVPHIL 299 F G +E+P +SH+S+G +SFTVP LDN G+IF VY + + +PHI Sbjct: 920 FFGGNEVPGQFSHKSRGSSISFTVPLLDNHRTRGLIFFVVYSNAGYDSPIIQHNCLPHIR 979 Query: 300 FKNESK 317 KN+SK Sbjct: 980 VKNKSK 985