BLASTX nr result
ID: Paeonia23_contig00032941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032941 (199 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHC69783.1| alcohol dehydrogenase [Quercus suber] 61 2e-08 ref|XP_002281349.2| PREDICTED: alcohol dehydrogenase 1 [Vitis vi... 60 2e-08 ref|NP_001268083.1| alcohol dehydrogenase 2 [Vitis vinifera] gi|... 60 2e-08 gb|AAF44335.1|AF195866_1 alcohol dehydrogenase 6 [Vitis vinifera] 60 2e-08 emb|CBI37553.3| unnamed protein product [Vitis vinifera] 60 2e-08 emb|CAN68504.1| hypothetical protein VITISV_039578 [Vitis vinife... 60 2e-08 ref|NP_001268090.1| alcohol dehydrogenase 7 [Vitis vinifera] gi|... 60 2e-08 emb|CAN68505.1| hypothetical protein VITISV_039579 [Vitis vinifera] 59 5e-08 ref|XP_002281363.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vi... 59 6e-08 sp|P48977.1|ADH_MALDO RecName: Full=Alcohol dehydrogenase gi|886... 61 8e-08 ref|XP_006472918.1| PREDICTED: alcohol dehydrogenase-like [Citru... 58 8e-08 ref|XP_006472917.1| PREDICTED: alcohol dehydrogenase-like [Citru... 58 8e-08 ref|XP_006434372.1| hypothetical protein CICLE_v10001500mg [Citr... 58 8e-08 ref|XP_006434371.1| hypothetical protein CICLE_v10001502mg [Citr... 58 8e-08 gb|AAY86033.1| alcohol dehydrogenase [Citrus x paradisi] 58 8e-08 ref|XP_002281334.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vi... 58 8e-08 ref|XP_002534157.1| alcohol dehydrogenase, putative [Ricinus com... 58 1e-07 gb|AAA98984.1| alcohol dehydrogenase 2d [Gossypium hirsutum] 59 1e-07 gb|AAA98985.1| alcohol dehydrogenase 1 [Gossypium hirsutum] 58 1e-07 gb|AAA98986.1| alcohol dehydrogenase 2c [Gossypium hirsutum] 57 2e-07 >gb|AHC69783.1| alcohol dehydrogenase [Quercus suber] Length = 381 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E S EINKAFEYML GEGLRCIIRMD Sbjct: 331 SDLPSVVEKYMNKELELEKFITHEVSFSEINKAFEYMLKGEGLRCIIRMD 380 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 +KGTFFG Y+P Sbjct: 319 IKGTFFGNYKP 329 >ref|XP_002281349.2| PREDICTED: alcohol dehydrogenase 1 [Vitis vinifera] Length = 415 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 365 SDLPSVVEKYMNKELELEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 414 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 353 LKGTFFGNYKP 363 >ref|NP_001268083.1| alcohol dehydrogenase 2 [Vitis vinifera] gi|9885274|gb|AAG01382.1|AF194174_1 alcohol dehydrogenase 2 [Vitis vinifera] gi|18027092|gb|AAL55726.1|AF271074_1 alcohol dehydrogenase 2 [Vitis vinifera] Length = 380 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELEVEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >gb|AAF44335.1|AF195866_1 alcohol dehydrogenase 6 [Vitis vinifera] Length = 380 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELEVEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >emb|CBI37553.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELELEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >emb|CAN68504.1| hypothetical protein VITISV_039578 [Vitis vinifera] gi|296088565|emb|CBI37556.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELEVEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|NP_001268090.1| alcohol dehydrogenase 7 [Vitis vinifera] gi|7264742|gb|AAF44336.1|AF195867_1 alcohol dehydrogenase 7 [Vitis vinifera] Length = 363 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRMD Sbjct: 313 SDLPSVVEKYMNKELEVEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMD 362 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 301 LKGTFFGNYKP 311 >emb|CAN68505.1| hypothetical protein VITISV_039579 [Vitis vinifera] Length = 380 Score = 58.9 bits (141), Expect(2) = 5e-08 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYML G+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELEXEKFITHEVPFAEINKAFEYMLQGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 5e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_002281363.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vinifera] Length = 380 Score = 58.5 bits (140), Expect(2) = 6e-08 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYML G+GLRCIIRMD Sbjct: 330 SDLPSVVEKYMNKELEVEKFITHEVPFAEINKAFEYMLQGDGLRCIIRMD 379 Score = 23.9 bits (50), Expect(2) = 6e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >sp|P48977.1|ADH_MALDO RecName: Full=Alcohol dehydrogenase gi|886885|emb|CAA88271.1| alcohol dehydrogenase [Malus domestica] Length = 380 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 35/53 (66%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = +3 Query: 30 TASDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 T +DI SVVEKYMNKE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 328 TRTDIPSVVEKYMNKELELEKFITHKVPFSEINKAFEYMLKGEGLRCIIRMEE 380 Score = 21.2 bits (43), Expect(2) = 8e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 1 LKGTFFGIYE 30 LKGTFFG Y+ Sbjct: 318 LKGTFFGNYK 327 >ref|XP_006472918.1| PREDICTED: alcohol dehydrogenase-like [Citrus sinensis] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_006472917.1| PREDICTED: alcohol dehydrogenase-like [Citrus sinensis] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_006434372.1| hypothetical protein CICLE_v10001500mg [Citrus clementina] gi|557536494|gb|ESR47612.1| hypothetical protein CICLE_v10001500mg [Citrus clementina] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_006434371.1| hypothetical protein CICLE_v10001502mg [Citrus clementina] gi|557536493|gb|ESR47611.1| hypothetical protein CICLE_v10001502mg [Citrus clementina] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >gb|AAY86033.1| alcohol dehydrogenase [Citrus x paradisi] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_002281334.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vinifera] gi|296088563|emb|CBI37554.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 58.2 bits (139), Expect(2) = 8e-08 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E EINKAFEYMLSG+GLRCIIRM+ Sbjct: 330 SDLPSVVEKYMNKELELEKFITHEVPFAEINKAFEYMLSGDGLRCIIRMN 379 Score = 23.9 bits (50), Expect(2) = 8e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >ref|XP_002534157.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223525768|gb|EEF28223.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 380 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SD+ SVVEKYM+KE E + EINKAFEYML GEGLRCIIRM+E Sbjct: 330 SDLPSVVEKYMSKELELEKFITHSVPFSEINKAFEYMLKGEGLRCIIRMEE 380 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 318 LKGTFFGNYKP 328 >gb|AAA98984.1| alcohol dehydrogenase 2d [Gossypium hirsutum] Length = 379 Score = 58.9 bits (141), Expect(2) = 1e-07 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMDE 179 SDI +VVEKYMNKE E + EINKAFE ML+GEGLRC+IRMDE Sbjct: 329 SDIPAVVEKYMNKELELDKFITHTVPFSEINKAFELMLAGEGLRCVIRMDE 379 Score = 22.7 bits (47), Expect(2) = 1e-07 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 +KGTFFG Y+P Sbjct: 317 VKGTFFGNYKP 327 >gb|AAA98985.1| alcohol dehydrogenase 1 [Gossypium hirsutum] Length = 181 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGN---P*CSVLEINKAFEYMLSGEGLRCIIRMD 176 SD+ SVVEKYMNKE E + +INKAF+YML+GEG+RCIIRMD Sbjct: 131 SDLPSVVEKYMNKELELEKFITQQVAFRDINKAFDYMLAGEGIRCIIRMD 180 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 119 LKGTFFGNYKP 129 >gb|AAA98986.1| alcohol dehydrogenase 2c [Gossypium hirsutum] Length = 77 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 36 SDILSVVEKYMNKEHEQGNP*CSVL---EINKAFEYMLSGEGLRCIIRMD 176 SDI +VVEKYMNKE E + EINKAFE ML+GEGLRC+IRMD Sbjct: 27 SDIPAVVEKYMNKELELDKFITHTVPFSEINKAFELMLAGEGLRCVIRMD 76 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 LKGTFFGIYEP 33 LKGTFFG Y+P Sbjct: 15 LKGTFFGNYKP 25